SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011992 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011992
Domain Number 1 Region: 509-659
Classification Level Classification E-value
Superfamily EF-hand 7.17e-51
Family Osteonectin 0.00000186
Further Details:      
 
Domain Number 2 Region: 454-506
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000388
Family Ovomucoid domain III-like 0.00053
Further Details:      
 
Domain Number 3 Region: 427-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family Follistatin (FS) module N-terminal domain, FS-N 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011992   Gene: ENSPANG00000014207   Transcript: ENSPANT00000006992
Sequence length 660
Comment pep:known_by_projection chromosome:PapAnu2.0:5:79004708:79031169:-1 gene:ENSPANG00000014207 transcript:ENSPANT00000006992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTGLFFLCILGTAAAIPTNARLLSDHAKPTAETVAPDNTAIPNLRAEDAENEKETAVSP
EDHSHRKAEKSSVLKSKEESHEQSAEQGKSSSQELGLKDQEDRDGDFSVNLEYAPTEGIL
DIKEDMSEPQEKKPSENTDFLAPSVSSFIDSNQQESITKREENQEQPRNYSHHQLNRSSK
HSQDLRDQGNQEQDPNISNGEEEKEKEPGEVGTHNDNQEGKTELPREDANSKQEEDNTKS
DDILEESDQPTQVSKMQEDEFEQDNQEQDDNSNAEMEEENASNINKHIQETEWLSQEGKT
GLEAISNHKEIDEKTVSEALLMEPTDDGTTMPRNHGADDDGGDDGDDDPRHSAGDDYFIP
SQAFLEAERAQSIAYHLKIEEQREKAHENENIDTSEPGEHQEAKKAENSSNDEETSSEGN
MRVHGVDSCMSFQCKRGHICKVDQQGKPHCVCQDPVTCPPTKLLDQVCGTDNQTYASSCH
LFATKCRLEGTKKGHQLQLDYFGACKSIPTCTDFEVTQFPLRMRDWLKNILMQLYEANSE
HAGYLNEKQRNKVKKIYLDEKRLLAGDHPIDLLLRDFKKNYHMYVYPVHWQFSELDQHPM
DRVLTHSELAPLRASLVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDENLLF
Download sequence
Identical sequences A0A096NGC2
ENSPANP00000011992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]