SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012012 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012012
Domain Number 1 Region: 80-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000103
Family TRASH domain 0.0063
Further Details:      
 
Domain Number 2 Region: 897-1298
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000000106
Family Hermes transposase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012012   Gene: ENSPANG00000007234   Transcript: ENSPANT00000008930
Sequence length 1325
Comment pep:known_by_projection chromosome:PapAnu2.0:1:37217143:37261872:-1 gene:ENSPANG00000007234 transcript:ENSPANT00000008930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEPLDGECGKAVVPQQELLDKIKEEPDNAQEYGRAQQPKIQESELKISGVFSVNERPLA
QQLNPGFQLSFTSSGPSVLIPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRC
ITRHSSPACLPPPPKKTCTNCSKDILNPKDVITTRFENSSPSKDFCSQSCLSSYELKKKP
VVTIYTKSISTKCSMCQKNADTRFEVKYQNVVHGLCSDACFSKFHSTNNLTMNCCENCGS
YCYSSSGPCQSQKVFSSTSVTAYKQNSAQIPPYALGKSLRPSAEMIETTNDSGKTELFCS
INCLSAYRVKTVTSSGVQVSCHSCKTSAIPQYHLAMSNGTIYSFCSSSCVVAFQNVFNKP
KGTNSSAMPLSQGQVVVSLPSSRSAVSTGGGNTSAVSSSSIRGSAAASLQPLAEQSQQVA
LTHTVVKLKCQHCNNLFATKPELLFYKGKMFLFCGKNCSDEYKKKNKVVAMCDYCKLQKI
IKETVRFSGVDKPFCSEVCKFLSARDFGERWGNYCKMCSYCSQTSPNLVENRLEGKLEEF
CCEDCMSKFTVLFYQMAKCDGCKRQGKLSESIKWRGNIKHFCNLFCVLEFCHQQIMNDSL
PQNKVNISKAKTAVMELPSARTDTTPVITSVVSLAKIPATLSTGNTNSVLKGAVSKEAAK
IIQDESTQAEAMKFPSSQSSQPSRLLKNKGISCKPVTQTKATSCKPHTQHKECQTDLPMP
NEKNDAELDSPPSKKKRLGFFQTYDTEYLKVGFIICPGSKESSPRPQCVICGEILSSENM
KPANLSHHLKTKHSELENKPVDFFEQKSLEMECQNSSIKKCLLVEKSLVKASYLIAFQTA
ASKKPFSIAEELIKPYLVEMCSEVLGSSAGDKMKTIPLSNVTIQHRIDELSADIEDQLIQ
KVRESKWFALQIDESSEISDITLLLCYIRFIDYDCRDVKEELLFCIEMPTRITGFEIFEL
INKYIDSKSLNWKHCVGLCTDGAASMTGRYSGLKAKIQEVAMNTAAFTHCFIHRERLVAE
KLSPCLHKILLQSAQILSFIKSNALNSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLK
RLFELRHEIEIFLSQKHSDLTKYFHDEEWVAKLAYLSDIFSLINELNLSLQGTLTTFFNL
CNKIDVFKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLNMTEITRIIFEHLEGLSQVFSD
CFPPEQDLRSGNLWIINPFMNHQNNNLTDFEEEKLTQLSSDLGLQSVFKSVSVTQFWINA
KTSYPELHERAMKFLLPFSTVYLCDAAFSALTESKQRNLLVSGPALRLAVTSLIPRIEKL
MKEKE
Download sequence
Identical sequences ENSPANP00000012012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]