SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012013 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012013
Domain Number 1 Region: 1496-1722
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-41
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 644-749
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-28
Family Cadherin 0.00085
Further Details:      
 
Domain Number 3 Region: 539-651
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-28
Family Cadherin 0.00045
Further Details:      
 
Domain Number 4 Region: 955-1067
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-28
Family Cadherin 0.00086
Further Details:      
 
Domain Number 5 Region: 322-425
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-25
Family Cadherin 0.00094
Further Details:      
 
Domain Number 6 Region: 852-954
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 1055-1172
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 1739-1949
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-24
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 9 Region: 427-537
Classification Level Classification E-value
Superfamily Cadherin-like 4e-24
Family Cadherin 0.00098
Further Details:      
 
Domain Number 10 Region: 750-850
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-20
Family Cadherin 0.00086
Further Details:      
 
Domain Number 11 Region: 1435-1475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000239
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 12 Region: 1163-1265
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000614
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 1983-2029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000312
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1947-1981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 2077-2116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 16 Region: 2105-2184
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000876
Family Hormone receptor domain 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012013
Domain Number - Region: 1414-1440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00779
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012013   Gene: ENSPANG00000013159   Transcript: ENSPANT00000026432
Sequence length 3317
Comment pep:known_by_projection chromosome:PapAnu2.0:2:86662860:86687164:1 gene:ENSPANG00000013159 transcript:ENSPANT00000026432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMARRPPWRGLGGRSTPILLLLLLSLFPLSQEELGGGGHQGWDPGLAATTGLRPHIGGRA
LALCPESPGVREDGGPGLGVREPVFVGLRGERQSSRNSRGPPEQPNEELRIEHGVQPLGS
RERETGQGPGSMLHWRPEISSCGRTGPLQRGSLSPGALSPGVPGSGNSSPLPSDFLVRHH
GPKPVSSQRNAGTGARKRVGTARCCGELRAIGSKSQGERATTSGAERTAPRRNCLPGASG
SGPELDSAPRTARTAPAPGSAPRESRTAPKPAPERMRSRGLFRRRFLPQRSGPRPPGIPA
RPEARKITSANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRL
VYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVA
VTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPLNANLRYRFVGPPAARA
AAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDEND
NAPQFSEKRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTG
EIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSV
LENAPLGHSVIHIQAVDADHGENARLEYSLTGVASDTPFVINSATGWVSVSGPLDRESVE
HYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTA
VDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHD
HCYVHINITDANTHRPVFQSAHYSVSVNEDRPVGSTIVVISASDDDVGENARITYLLEDN
LPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQ
FVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVR
TVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENS
IVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVI
VVQATSAPLVSRATVHVRLIDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDP
DVSDHLFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCV
LRVVIITEELLANSLTVRLENMWQERFLSPLLGRFLEGVAEVLATPAEDVFIFNIQNDTD
VGGTVLNVSFSALAPRGAGAGAAGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCL
REPCENYMKCVSVLRFDSSAPFLASASTLFRPIQPIAGLRCRCPPGFTGDFCETELDLCY
SNPCRNGGACARREGGYTCVCRPRFTGEDCELDTEAGRCVPGVCRNGGTCTDAPNGGFRC
QCPAGGAFEGPRCEVAARSFPPSSFVMFRGLRQRFHLTLSLSFATVQQSGLLFYNGRLNE
KHDFLALELVAGQVRLTYSTGESNTVVSPTVPGGLSDGQWHTVHLKYYNKPRTDALGGAQ
GPSKDKVAVLSVDDCDVAVALQFGAEIGNYSCAAAGVQTSSKKSLDLTGPLLLGGVPNLP
ENFPVSHKDFIGCMRDLHIDGRRMDMAAFVANNGTMAGCQAKLHFCDSGPCKNSGFCLER
WGGFSCDCPVGFGGKDCRLTMAHPHHFRGNGTLSWNFGSDMAVSVPWYLGLAFRTRATQG
VLMQVQAGPHSTLLCQLDRGLLSVTVTRGSGRASHLLLDQVTVSDGRWHDLRLELQEEPG
GRRGHHVLMVSLDFSLFQDTMAVGSELQGLKVKQLHVGGLPPGSAEEAPQGLVGCIQGVW
LGSTPSGSPALLPPSHQVNAEPGCVMTNACASGPCPPHADCRDLWQTFSCICRPGYYGPG
CVDACLLNPCQNQGSCRHLPGAPHGYTCDCVGGYFGHHCEHRMDQQCPRGWWGSPTCGPC
NCDVHKGFDPNCNKTNGQCHCKEFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRP
GALGRQCNSCDSPFAEVTASGCRVLYDACPKSLRSGVWWPQTKFGVLATVPCPRGALGLR
GAGAAVRLCDEAQGWLEPDLFNCTSPAFRELSLLLDGLELNKTALDTMEAKKLAQRLREV
TGHTDHYFSQDVRVTARLLAHLLAFESHQQGFGLTATQDAHFNENLLWAGSALLAPETGD
LWAALGQRAPGGSPGSAGLVRHLEEYAATLARNMELTYLNPMGLVTPNIMLSIDRMEHPS
SPRGAHRYPRYHSNLFRGQDAWDPHTHVLLPSQSPRPSPSEVLPTSSSMENSTTSSVVPR
PAPPEPEPGISIIILLVYRTLGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFHGRNFL
RGVLESPISLEFRLLQTANRSKAICVQWDPPGLAEQHGVWTARDCELVHRNGSHARCRCS
RTGTFGVLMDASPRERLEGDLELLAVFTHVVVAVSVAALVLTAAVLLSLRSLKSNVRGIH
ANVAATLGMAELLFLLGIHRTHNQLVCTAVAILLHYFFLSTFAWLFVQGLHLYRMQVEPR
NVDSGAMRFYHALGWGVPAVLLGLAVGLDPEGYGNPDFCWISVHEPLIWSFAGPIVLVIV
MNGTMFLLAARTSCSTGQREAKKTSALTLRSSFLLLLLVSASWLFGLLAVNHSILAFHYL
HAGLCGLQGLAALLLFCVLNADARAAWTPACLGRKAAPEEARPAPGTGPGAYNNTALFEE
SGLIRITLGASTVSSVSSARSGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHSLQAHAG
PTDLDVAMFHRDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLRRAAQSER
LLTHPKDVDGNDLLSYWPALGECEAAPCALQTWGSERRLGLDTNKDAANNNQPDPALTSG
DETSLGRAQRQRKGILKNPLQYPLVPQTRGAPELSWCRAATLGHRAVPAASYGRIYAGRG
TGSLSQPASRYSSREQLDLLLRRQLSRERLEEAPDPVPHPLSRPGSQECMDAAPGRLEPR
DRGSTLPRRQPPRDYPGAMAGRFGSRDALDLGAPREWLSTLPPPHCTRNLDPQPPPLSLS
PQRQLSRDPLLPSRPLDSLSRSSNSRERLDQVPSRHPSREALGPPPQLLRAREDPVSGPS
HGPSTEQLDILSSILASFNSSALSSVQSSSTPSGPHTTATPSATASVLGPSTPRSATSHS
ISELSPDSEVPRSEGHS
Download sequence
Identical sequences ENSPANP00000012013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]