SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012018 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012018
Domain Number 1 Region: 199-320
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-42
Family Third domain of FERM 0.000000529
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-38
Family Second domain of FERM 0.000000602
Further Details:      
 
Domain Number 3 Region: 487-575
Classification Level Classification E-value
Superfamily Moesin tail domain 1.44e-31
Family Moesin tail domain 0.0000262
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-26
Family First domain of FERM 0.00000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012018   Gene: ENSPANG00000016175   Transcript: ENSPANT00000013815
Sequence length 575
Comment pep:known_by_projection chromosome:PapAnu2.0:4:103493198:103548304:1 gene:ENSPANG00000016175 transcript:ENSPANT00000013815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFFPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTELWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERLNLPVPLFPCTRQQEQMMREKEELMLRLQDYEEKTKKAER
ELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAE
YTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAYEPLSYHVQESLQD
EGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHND
IIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences ENSPANP00000012018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]