SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012088 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012088
Domain Number 1 Region: 185-410
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.75e-66
Family Mitochondrial carrier 0.0000638
Further Details:      
 
Domain Number 2 Region: 7-160
Classification Level Classification E-value
Superfamily EF-hand 1.83e-33
Family Calmodulin-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012088   Gene: ENSPANG00000008553   Transcript: ENSPANT00000026762
Sequence length 429
Comment pep:known_by_projection chromosome:PapAnu2.0:19:6201064:6219164:-1 gene:ENSPANG00000008553 transcript:ENSPANT00000026762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDA
DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISITLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEK
LTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGIRS
LWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPM
EVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLK
NWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQGEAWAGGWGRESL
IAWAPASPR
Download sequence
Identical sequences ENSPANP00000012088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]