SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012194 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012194
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily PX domain 1.44e-32
Family PX domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012194   Gene: ENSPANG00000006089   Transcript: ENSPANT00000001570
Sequence length 201
Comment pep:known_by_projection chromosome:PapAnu2.0:3:84579886:84663650:-1 gene:ENSPANG00000006089 transcript:ENSPANT00000001570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCVRRRYREFVWL
RQRLQSNALLVQLPELPSKNLFFNMNNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLF
LQSHLNSEDIEACVSGQTKYSVEEAIHKFALMNRRFPEEDEEGKKENDIDYDSESSSSGL
GHSSDDSSSHGCKVNTAPQES
Download sequence
Identical sequences A0A024RA70 A0A096NGV5 A0A0D9RNY9 A0A2K5JJY8 A0A2K5R6W5 A0A2K5X9H7 A0A2K5XL31 A0A2K6C054 A0A2K6PVZ6 A0A2K6TGR7 F7E6U3 F7IN97 G1RY44 G3S6L1 H2QUB0 Q9Y5X0
9544.ENSMMUP00000035172 9598.ENSPTRP00000032481 9606.ENSP00000343709 ENSCJAP00000014736 ENSCJAP00000047094 ENSP00000343709 ENSP00000379661 ENSP00000395474 ENSMMUP00000030576 ENSMMUP00000035172 gi|23111023|ref|NP_037454.2| gi|315360660|ref|NP_001186764.1| ENSP00000343709 ENSP00000379661 ENSNLEP00000018171 NP_001186764.1.87134 NP_001186764.1.92137 NP_001253824.1.72884 NP_001305128.1.87134 NP_001305128.1.92137 NP_037454.2.87134 NP_037454.2.92137 XP_001161774.1.37143 XP_001161811.1.37143 XP_001161850.1.37143 XP_003935195.1.74449 XP_004045250.1.27298 XP_004045252.1.27298 XP_005549997.1.63531 XP_006715775.1.92137 XP_007980014.1.81039 XP_007980015.1.81039 XP_009000493.1.60252 XP_009000494.1.60252 XP_009000495.1.60252 XP_009000497.1.60252 XP_009000498.1.60252 XP_010354833.1.97406 XP_011729523.1.29376 XP_011729524.1.29376 XP_011793961.1.43180 XP_011827670.1.47321 XP_012352426.1.23891 XP_012352427.1.23891 XP_012352428.1.23891 XP_012352429.1.23891 XP_015303105.1.63531 XP_017382512.1.71028 XP_017382513.1.71028 XP_017382514.1.71028 XP_017382515.1.71028 XP_017382516.1.71028 XP_018887228.1.27298 ENSPANP00000012194 ENSGGOP00000018109 ENSMMUP00000030576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]