SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012208 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012208
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.8e-27
Family spliceosomal protein U5-15Kd 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012208   Gene: ENSPANG00000023246   Transcript: ENSPANT00000013016
Sequence length 149
Comment pep:known_by_projection chromosome:PapAnu2.0:20:54450350:54454679:1 gene:ENSPANG00000023246 transcript:ENSPANT00000013016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTYSDLSKMAAIYL
VDVDQTPVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIY
RGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Download sequence
Identical sequences A0A096NGW9
ENSPANP00000012208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]