SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012373 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012373
Domain Number 1 Region: 1579-1821
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-53
Family Ankyrin repeat 0.00000094
Further Details:      
 
Domain Number 2 Region: 512-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000135
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 474-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000365
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 964-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000042
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 550-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 6 Region: 351-479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000011
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 588-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000116
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 276-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000255
Family EGF-type module 0.019
Further Details:      
 
Domain Number 9 Region: 922-1047
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000314
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 10 Region: 193-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000583
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 157-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 730-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000396
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 689-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000438
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1043-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000602
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 235-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000144
Family EGF-type module 0.023
Further Details:      
 
Domain Number 16 Region: 1249-1280
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0025
Further Details:      
 
Domain Number 17 Region: 313-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000544
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 807-930
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000753
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 65-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000439
Family EGF-type module 0.02
Further Details:      
 
Domain Number 20 Region: 30-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000809
Family EGF-type module 0.025
Further Details:      
 
Domain Number 21 Region: 1212-1242
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 22 Region: 119-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000305
Family EGF-type module 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012373
Domain Number - Region: 1171-1200
Classification Level Classification E-value
Superfamily Notch domain 0.00314
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 1085-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0043
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1130-1168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00629
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 625-656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 661-690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0484
Family EGF-type module 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012373   Gene: ENSPANG00000021734   Transcript: ENSPANT00000007832
Sequence length 2003
Comment pep:known_by_projection chromosome:PapAnu2.0:4:31486219:31515468:-1 gene:ENSPANG00000021734 transcript:ENSPANT00000007832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKPPGFLLPRKQLRLCVSVVITRGLLCGTFPEPCANGGTCLSLSLGQGTCQCAPGFLGET
CQFPDPCQNAQLCQNGGSCQALLPAPLGPPSSPSPLAPNFSCTCLPGFTGERCQAQIEDP
CPPSFCSKRGHCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQCR
CPPGFEGHTCERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGREGPRCELRAGPCPPR
GCSNGGTCQLMPGKDSTFHLCLCPPGFIGPDCEVNPDNCVNHQCQNGGTCQDGLDTYTCL
CPETWTGWDCSEDVDECEAQGPPRCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCIA
ATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLCQ
PGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLS
QPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASDPCLNHAGCHDLLNGFQCICLP
GFAGTRCEEDIDECSSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPVG
ASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAPP
EDNCTCHHGHCQRTRSSCVCDVGWTGPECEAELGGCVSAPCAHGGTCYPQPSGYNCTCPI
GYTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTITDYCVSVSCHFG
VVASQQHHTLPSPCFLNFFLSCPVSVLFSPCRNRATCQDSPQGPRCLCPTGYTGGSCQTL
MDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSLCQNG
GLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQHGATCMAQPSGYLCQCAPGYNGQN
CSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACH
SLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTC
SHRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLNGYGGPDCLTPPAPKGCGPPSPCLYNG
SCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCS
LGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCHDHFH
NGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLSLTLR
VGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPSYQERSAPQTQPLGKETDSLSAGFVVV
MGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTALPPAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRR
RPPLGEDSIGLKALKPEAEVDEDGVVMCSGPEEGEEVGQAEETGPPSKCQFWSLSGGCGE
LPQAAMLTPPQESEMEAPDLDTCGPDGVTPLMSAVCCGEVESRTFQGAWLGCPGPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVARQRNHWDLLTLLEGAGPLEARHKATPGRESGPFPRARTSSVSVPPHGGGALPR
CRTLSAGAGPRGGGACRQARTWSVDLAVRGGGAYYHCRSFSGGGAGGGPPPRGRRFSAGM
RGPRPNPAIMRGSYGVAAGRGGRGPTDDWPCDWVALGACGPASNIPNPPSCLTPSPERGS
PQLDWGPPAHQEMPINQGGEGKK
Download sequence
Identical sequences ENSPANP00000012373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]