SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012634 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012634
Domain Number 1 Region: 215-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000189
Family LIM domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012634
Domain Number - Region: 273-305
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000389
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012634   Gene: ENSPANG00000017338   Transcript: ENSPANT00000025115
Sequence length 444
Comment pep:known chromosome:PapAnu2.0:4:41115482:41120905:1 gene:ENSPANG00000017338 transcript:ENSPANT00000025115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGASHSPGAPDAPSFLAAWSRGSAVSGYSGCEQPILATFHRKPDLRDRRGRKQPLPLM
SVQNSGWPHQEDSPKPQDPGPPANSDSDSGHLPEEDPEDTSAQGPSVLSLGSLCLDTNQA
PKWTGLRTLLQQLPPQDIDEHYCLALGEEERAELRLFCSRRKQEALGQGVARLVLPKLEG
HTCEKCRELLKPGEYGVFAARAGEQRCWHQTCFACQACGQALINLIYFYHDGQLYCGRHH
AELLRPRCPACDQLIFSQHCTEAEGQRWHENHFCCQDCAGPLGGGRYALPGGSPCCPSCF
ENRYSDAGSSWAGALEGQAFLGETGPDRTGGRHQTSVNSATLSRTLLLAAAGGSSLQTQT
GLPGSSPQQENRPGEKAEAAKGQEQCRLETLCDSKDTLFSTCSSSSDSEPEGFFLGERLP
LSWKIPGSLQAEDSNASKKHCTMC
Download sequence
Identical sequences A8MN28
ENSPANP00000012634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]