SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012930 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000012930
Domain Number - Region: 88-132
Classification Level Classification E-value
Superfamily ISP domain 0.0641
Family Rieske iron-sulfur protein (ISP) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012930   Gene: ENSPANG00000016346   Transcript: ENSPANT00000028710
Sequence length 235
Comment pep:known_by_projection chromosome:PapAnu2.0:3:5218312:5271704:-1 gene:ENSPANG00000016346 transcript:ENSPANT00000028710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLVSGPLKVVFLVLASLCAWYSGYLLAELIPDAPLSSAAYSIHSIGERPVLKAPVPKR
QKCDHWTPCPSDTYAYRLLSGGGINKYAKICFEDDLLMGEKLGNVARGINIAIVNYVTGN
VTATQHFDMYEGDNSGPMIKFIQSAPPKSLLFMVTYDDGSTRLNNDAKNAIEELGSKEIR
NMKFRSSWVFLAAKGFELPSEIQREKINHSDTKNNRYSGWPAEIQIEGCIPKEPS
Download sequence
Identical sequences A0A096NIY2 A0A2K5X134 A0A2K6CSB9 H9ZA89
ENSPANP00000012930 ENSMMUP00000005689 XP_005548710.1.63531 XP_011724297.1.29376 XP_014988334.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]