SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013036 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013036
Domain Number 1 Region: 52-188
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.12e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 1-51
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000829
Family Glutathione S-transferase (GST), N-terminal domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013036   Gene: ENSPANG00000008069   Transcript: ENSPANT00000020393
Sequence length 198
Comment pep:novel chromosome:PapAnu2.0:4:51944088:51949185:-1 gene:ENSPANG00000008069 transcript:ENSPANT00000020393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEEKFLESAEDLEKLRNDGSLMFQQVPIVEIDGMKLVQTRAILNYIASKYNLYGKDIKER
ALYEVTVSTLPQVETVIFCLDHCQFQRMTRTKAKSEEDVNVLKYFNKYHISHSEIRKSHG
QDYLVGNELSRADIHLVELLYYVEELDSSLISSFPLLKGLKTRISNLPTVKKFLQPGSPR
KPPMDAITLEEARKTFGF
Download sequence
Identical sequences ENSPANP00000013036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]