SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Papio anubis 76 > ENSPANP00000013226

Domain assignment for ENSPANP00000013226 from Papio anubis 76

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPANP00000013226
Domain Number 1	Region: 209-246
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000291
Family	EGF-type module	0.0075
Further Details:

Domain Number 2	Region: 88-133
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000011
Family	EGF-type module	0.014
Further Details:

Domain Number 3	Region: 131-174
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000583
Family	EGF-type module	0.014
Further Details:

Domain Number 4	Region: 167-207
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000215
Family	EGF-type module	0.01
Further Details:

Weak hits

Sequence:	ENSPANP00000013226
Domain Number -	Region: 57-89
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00805
Family	EGF-type module	0.057
Further Details:

Domain Number -	Region: 30-58
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0979
Family	EGF-type module	0.043
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPANP00000013226 Gene: ENSPANG00000019235 Transcript: ENSPANT00000022095
Sequence length	377
Comment	pep:known_by_projection chromosome:PapAnu2.0:7:156901634:156911523:1 gene:ENSPANG00000019235 transcript:ENSPANT00000022095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTATEALLRVLLLLLAFGHSTHGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS PGCLHGLCEEPWQCICTDGWDGELCDRDVRACSSTPCANNGTCVSLDDGLYECSCAPGYS GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASGPCQNGGTCLQHTQVSYECLCKPEFT GLTCVKKRALSPQQVTHLPSGYGLTYRLTPGVHELPVPQPEHRILKVSMKELNKNTPLLT EGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNRMLRKKKNLLLQLAVNIIFP EKIDMTTFSKEAGSEEI
Download sequence
Identical sequences	A0A096NJS3 ENSPANP00000013226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]