SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013226 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013226
Domain Number 1 Region: 209-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000291
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 2 Region: 88-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 131-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000583
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 167-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000215
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013226
Domain Number - Region: 57-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00805
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 30-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0979
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013226   Gene: ENSPANG00000019235   Transcript: ENSPANT00000022095
Sequence length 377
Comment pep:known_by_projection chromosome:PapAnu2.0:7:156901634:156911523:1 gene:ENSPANG00000019235 transcript:ENSPANT00000022095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATEALLRVLLLLLAFGHSTHGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS
PGCLHGLCEEPWQCICTDGWDGELCDRDVRACSSTPCANNGTCVSLDDGLYECSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASGPCQNGGTCLQHTQVSYECLCKPEFT
GLTCVKKRALSPQQVTHLPSGYGLTYRLTPGVHELPVPQPEHRILKVSMKELNKNTPLLT
EGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNRMLRKKKNLLLQLAVNIIFP
EKIDMTTFSKEAGSEEI
Download sequence
Identical sequences A0A096NJS3
ENSPANP00000013226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]