SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013352 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013352
Domain Number 1 Region: 380-509
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000251
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 2 Region: 669-795
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000141
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 3 Region: 316-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000258
Family EGF-type module 0.008
Further Details:      
 
Domain Number 4 Region: 567-609
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000176
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 280-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 602-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000116
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 238-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000727
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 646-680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000858
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013352
Domain Number - Region: 533-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000343
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 801-857
Classification Level Classification E-value
Superfamily FnI-like domain 0.0022
Family VWC domain 0.083
Further Details:      
 
Domain Number - Region: 356-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0576
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013352   Gene: ENSPANG00000016732   Transcript: ENSPANT00000025255
Sequence length 1176
Comment pep:known_by_projection chromosome:PapAnu2.0:7:161365882:161395491:-1 gene:ENSPANG00000016732 transcript:ENSPANT00000025255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGL
VIIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAH
LELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGC
NLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWGGLLCDKDLN
YCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGF
ECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEG
KPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVNGYQCVCPRG
FGGRHCELERDECASSPCHSGGLCEDLADGFRCHCPQGFSGPLCEVDVDLCEPSPCRNGA
RCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGAPGAAASGVCGPH
GRCVSQPGGNFSCVCDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGE
LCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDTYTCSNGGTCYD
SGDTFRCACPPGWKGSTCTVAKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTHN
TNDCNPLPCYNGGICVDGVNWFRCECAAGFAGPDCRINIDECQSSPCAYGATCVDEINGY
RCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWK
PCLLAGQPEALSAQCPPGQRCLEKAPGQCLRPPCEAWGECGTEEPPSTPCLPRSGHLDNN
CARLTLRFNRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSGASAVEVAVS
FSPARDLPDSSLIQGAAHAIVAAITQRGNGSLLLAVTEVKVETVVMGGSSTGLLVPMLCG
AFSVLWLACVVLCVWWTRKRRKERERSRLPREESTNNQWAPLNPIRNPIERPGGGPWGGG
GHKDVLYQCKNFTPPPRRADEALPGPAGHAGVREDEEDEDLGRGEEDSLEAEKFLSHKFT
KDPGRSPGRPAHWASGPKVDNRAVRSINEARYTGKE
Download sequence
Identical sequences ENSPANP00000013352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]