SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013386 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013386
Domain Number 1 Region: 282-334
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000239
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013386
Domain Number - Region: 383-426
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0143
Family Erythroid transcription factor GATA-1 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013386   Gene: ENSPANG00000013433   Transcript: ENSPANT00000012141
Sequence length 711
Comment pep:known_by_projection chromosome:PapAnu2.0:7:161646185:161700991:1 gene:ENSPANG00000013433 transcript:ENSPANT00000012141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRVGDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISSTLIALADKHAT
LSVCYKAGPGADNGEEGEIEEEMENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRG
KCSVTLLNETESLKSYLEREDFFFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEG
EEDGRDQSKLETKVWEAHNPLTDKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAA
ASRDITLFHAMDTLHKNIYDISKAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYG
KDFTDIQQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNP
NQISVNNVKAGVVNGTGAPGQSPGAGRACESCYTTQSYQWYSWGPPNMQCRLCASCWTYW
KKYGGLKMPTRLDGERPGPNRSNMSPHGLPARSSGSPKFAMKTRQAFYLHTTKLTRIARR
LCREILRPWHAARHPYLPINSAAIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETH
PRPPKPDPVKSVSSVLSSLTPAKAAPVINNGSPTILGKRSYEQHNGVDGNMKKRLLMPSR
GLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEE
TRKIRKLLSSSETKRAARRPYKPIALRQSQALPLRPPPPAPVNDEPIVIED
Download sequence
Identical sequences ENSPANP00000013386 XP_011753365.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]