SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013425 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013425
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Globin-like 1.27e-44
Family Globins 0.0000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013425   Gene: ENSPANG00000019686   Transcript: ENSPANT00000026981
Sequence length 142
Comment pep:known chromosome:PapAnu2.0:20:47428:49178:1 gene:ENSPANG00000019686 transcript:ENSPANT00000026981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSAEDRALVRALWKKLGSNVGVYATEALERTFLAFPATKTYFSHLDLSPGSAQVRAHG
QKVADALSLAVERLDDLPRALSALSHLHACQLRVDPANFPLLGHCLLVTLARHYPGDFSP
ALQASLDKFLSHVISALASEYR
Download sequence
Identical sequences A0A1K0GUX6 A0A2K5MX97 A0A2K5V9Y0 A0A2K6CQE3 A9L8U0
ENSPANP00000013425 ENSMMUP00000032826 XP_002802384.1.72884 XP_005590789.1.63531 XP_011746863.1.29376 XP_011746864.1.29376 XP_011891118.1.92194 ENSMMUP00000032826 9544.ENSMMUP00000032826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]