SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013531 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013531
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily PX domain 3.27e-18
Family PX domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013531   Gene: ENSPANG00000006904   Transcript: ENSPANT00000023347
Sequence length 194
Comment pep:known_by_projection chromosome:PapAnu2.0:4:3487663:3516136:-1 gene:ENSPANG00000006904 transcript:ENSPANT00000023347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FEIRTEWSDRSVLYLHRSLADLGRLWQRLRDAFPEDRSETLSISVSILGLVAIKEAHDIE
TRLNEVEKLLKTIISMPCKYSRSEVVLTFFERSPLDQVLKNDNVHKIQPSFQSPVKISEI
MRSNGFCLANTETIVIDHSIPNGRDQHLGMDPTEHLFENGSEFPSELEDGDDPAAYVTNL
SYYHLVPFETDILD
Download sequence
Identical sequences ENSPANP00000013531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]