SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013569 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013569
Domain Number 1 Region: 283-420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 413-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 3 Region: 156-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000298
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 452-510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000368
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 190-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000671
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 6 Region: 498-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000869
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013569   Gene: ENSPANG00000012451   Transcript: ENSPANT00000024969
Sequence length 677
Comment pep:known_by_projection chromosome:PapAnu2.0:10:85705628:85788304:1 gene:ENSPANG00000012451 transcript:ENSPANT00000024969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDADVLLEACCADGQRMATNQKDCSLPYATESKECRMVQEQCCHSQLEELHCATGISLAN
QQDHCVAPRGDNASLEATFVKRCCHCCLLGRAAQAQGQSCEYSLMVGYQCGQVFRACCVK
SQETGDLDVRSLQETDKITEVAEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQ
LLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGTGYELTEDNSCKALPQA
FSLLKNCFKKYICGESLGGKDRAPCSQTQPMFYIDFLSDSVDINECLSISAPCPTGHTCI
NTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGRGHRCVNSPGSFRCECKT
GYYFDGISRMCVDVNECQRYPGRLCGHKCENTLGSYVCSCSVGFRLSVDGRSCEDINECS
SSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCINIPGSFQ
CSCPSSGYRLAPNGRNCQDIDECVTGIHNCSINETCFNIQGGFRCLVFECPENYRRSAAT
LQQEKTDTIRCIKSCRPNDVTCVFDPVHTISHTVISLPTFREFTRPEEIIFLRAITPPQP
ASQANIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIVGPFHAILKLEMNYVVGGVV
SHRNVVNVHIFVSEYWF
Download sequence
Identical sequences ENSPANP00000013569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]