SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013649 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013649
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily PX domain 4.06e-25
Family PX domain 0.00089
Further Details:      
 
Domain Number 2 Region: 234-290
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 3 Region: 155-216
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000223
Family SH3-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013649   Gene: ENSPANG00000000513   Transcript: ENSPANT00000000989
Sequence length 374
Comment pep:known_by_projection chromosome:PapAnu2.0:20:1859417:1861568:-1 gene:ENSPANG00000000513 transcript:ENSPANT00000000989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRYPVSVQGAALVQIKRLQTFAFCVRWSDGSDTFVRRSWDEFRRLKKTLKETFPVEA
GLLRRSDRVLPKLLDAPLLAHGGRTSRGLARLQLLETYSRRLLATAERVARSPAITGFFA
PQPVDLEPALPPGSRVILPAPEEPPVSRAAGRLSIHSLETQSLRCLQPFCTQDTRNRPFQ
ARAQESLDVLLRHPSGWWLVENEDQQMAWFPAPYLEAAAAPGRGRETGGSLGSSGPQFCA
SRAYESNRADELSVPAGARVRVLEKSDRGWWLCRYGDREGLLPAVLLRPEGLGALLSGTG
FRGGDDPAGEARGSREASQATAPPPTVPTRPSPGAIQSRCCTVTRRALERRPGRQGPSQG
CVDPVPVPHPTTER
Download sequence
Identical sequences ENSPANP00000013649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]