SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013715 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013715
Domain Number 1 Region: 438-548
Classification Level Classification E-value
Superfamily TIMP-like 2.79e-21
Family Netrin-like domain (NTR/C345C module) 0.07
Further Details:      
 
Domain Number 2 Region: 311-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000279
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 255-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.028
Further Details:      
 
Domain Number 4 Region: 374-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013715   Gene: ENSPANG00000021609   Transcript: ENSPANT00000013178
Sequence length 551
Comment pep:known_by_projection chromosome:PapAnu2.0:20:2361995:2364384:1 gene:ENSPANG00000021609 transcript:ENSPANT00000013178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGWPWGLLLTAGTLFAALSPGPPAPADPCHDEGGAPRGCVPGLVNAALGREVLASSTCG
RPATRACDASDPRRAHPPALLTSPGGTASPLCWRSEWLPRAPLNVTLTVPLGKAFELVFV
SLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPADGPAGPGPEALCFPA
PQAQPDGSGLLAFSVQDSSPPGLDLDSSPVLQDWVTATDIRVVLTRPSAAGDPRDMEAIV
PYSYAATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRA
TARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRD
PGRALSDRRACRACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAP
CVKTPIPGPTEDSSPVQPQDCDLHCKPARGNYRISLKKFCRKDYAVQVAWTRFPVAVLAV
FRSGEERARRGSSALWVPAGDAACGCPRLLPGRRYLLSAARGSLVLPWRDAWTRRLRRLQ
RRERRGRCSAA
Download sequence
Identical sequences ENSPANP00000013715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]