SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013913 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013913
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 7.59e-17
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 
Domain Number 2 Region: 846-885
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000117
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 904-932
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000455
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number 4 Region: 768-801
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000471
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013913
Domain Number - Region: 630-660
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.014
Family CCCH zinc finger 0.0077
Further Details:      
 
Domain Number - Region: 504-532
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0608
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013913   Gene: ENSPANG00000015185   Transcript: ENSPANT00000026893
Sequence length 971
Comment pep:known_by_projection chromosome:PapAnu2.0:20:11101456:11148457:-1 gene:ENSPANG00000015185 transcript:ENSPANT00000026893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLHALVRNLFNEGNDVYRERDWN
NSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSFNA
SNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AELSLKSVPGDGATKALNHSVEDIEPDLLTPRQEAVPVVSLPAPSFSHEVGSELASVPVM
PLTSILPLQVEESTLPSAVLANGGKMPFTMPEAFLDDGDMVLGDELDDLLDSAPETNETV
MPSALVRGPLQTASVSPSMPFSASLLGTLPIGARYAPPPSFSEFYPPLTSSLEDFCSSLN
SFSMSESKRDLSTSTSREGTPLNNSNSSLLLMNGPGSLFASENFLGISSQPRNDFGNFFG
SAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIK
NVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKGA
FSREAFFGGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISKRNKDNSTACSHPVTK
HEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELKV
WIMQNETGISHDAIAQESKRYWQNLEANVPGAQVLGNQMMPGFLNMKIKFVCAQCLRNGQ
VIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIAS
GKKCQYVGNCSFAHSPEEREVWTYMKENGIQDMEQFYELWLKSQKNEKSEDVASQSNKEN
GKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFP
TGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDF
GKYSFLFKDLN
Download sequence
Identical sequences A0A096NLQ5 A0A2K6CLQ2 F6WWT4
ENSPANP00000013913 9544.ENSMMUP00000032628 NP_001244769.1.72884 XP_011715750.1.29376 XP_014981084.1.72884 XP_014981085.1.72884 ENSMMUP00000032628 ENSMMUP00000014738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]