SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013915 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013915
Domain Number 1 Region: 221-415
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-40
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 80-150
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000424
Family RING finger domain, C3HC4 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013915   Gene: ENSPANG00000018611   Transcript: ENSPANT00000005747
Sequence length 420
Comment pep:known_by_projection chromosome:PapAnu2.0:4:29527061:29531738:-1 gene:ENSPANG00000018611 transcript:ENSPANT00000005747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWRDLPRLRLWLKTEAIPGEGRKAAKVNAGVGEKGIYTASSRGGPPSARSKAVAVVAQG
AASRSRLSMDAPELGPGLVERLEQLATCPLCGGSFEDPVLLACEHSFCRACLARRWGTPP
ATDTEASPTACPCCGLPCPRRSLRSNVRLAVEVRISRELREKLAEPGARAGRRRGGRIPT
MGCLDPPGEDMRKTWRRFEVPTPKSSKSEDDLPEDYPVVKNMLHRLTADLTLDPGTAHRR
LLISADRRSVQLAPPGTPAPPDGPKRFDQLPAVLGAQGFGAGRHCWEVETADAASCRDSS
GEDEDDEESHYAVGAAGESVQRKGCVRLCPAGAVWAVEGRGGRLWALTAPEPTLLGGAEP
PPRRIRVDLDWERGRVAFYDGRSLDLLYAFQASAPLGERIFPLFCTCDPRAPLRIVAAES
Download sequence
Identical sequences A0A096NLQ7
ENSPANP00000013915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]