SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013927 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013927
Domain Number 1 Region: 189-365
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-42
Family RUN domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013927
Domain Number - Region: 436-478
Classification Level Classification E-value
Superfamily eIF1-like 0.0497
Family eIF1-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013927   Gene: ENSPANG00000017494   Transcript: ENSPANT00000006484
Sequence length 677
Comment pep:novel chromosome:PapAnu2.0:20:11341374:11434157:1 gene:ENSPANG00000017494 transcript:ENSPANT00000006484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCPWGSSQAGFVSSPRSELKSRLLREALRDCPSACDHALSRYSLFISFPARIPLWDKV
AHHSWLSSLSVAPTGVGTSGGQERRLGDLGTVTPPRGVSGPPGVPSPRRLCIALHTRSRN
LDLRRCLRSGSAGGALSAVRLCFRGGAAGAGLLSPGLSGARRPQRRQRRRRGAGTGPGSG
IMSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKR
SRGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQRFYSLRHIASDVGRGRAWL
RCALNEHSLERYLHMLLADRCRLSTFYEDWSFVMDEERSSMLPTMAAGLNSILFAINIDN
KDLNGQSKFAPTVSDLLKESTQNVTSLLKESTQGVSSLFREITASSAVSILIKPEQETDP
LPVVSRNVSADAKCKKERKKKKKVTNIISFDDEEDEQNSGDVFKKTPGAGESSEDNSDRS
SVNIISAFESPFGPNSNGSQSSNSWKIDSLSLNGEFGYQKLDVKSIDDEDVDENEDDVYG
NSSGRKHRGHAESPEKPLDGNTCLSQMHSWAPLKVLHNDSDILFPVSGVGSYSPADAPLG
SLENGTGPEDHVLPDPGLRYSVEASSPGHGSPLSSLLPSASVPESMTISKYFCSHLHQLW
DDSWPLSHGSAFVLIAL
Download sequence
Identical sequences ENSPANP00000013927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]