SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014017 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014017
Domain Number 1 Region: 947-1016
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-18
Family TB module/8-cys domain 0.00071
Further Details:      
 
Domain Number 2 Region: 1846-1977
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.98e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 2331-2403
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-18
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 4 Region: 2050-2119
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.43e-17
Family TB module/8-cys domain 0.00000899
Further Details:      
 
Domain Number 5 Region: 1530-1625
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-17
Family TB module/8-cys domain 0.00000916
Further Details:      
 
Domain Number 6 Region: 534-654
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-17
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 7 Region: 448-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.29e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 8 Region: 1025-1166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 1316-1450
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-16
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 179-264
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 11 Region: 2446-2573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-16
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 12 Region: 1684-1750
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-16
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 13 Region: 325-391
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000183
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 14 Region: 844-928
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000209
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 15 Region: 1195-1322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000377
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 16 Region: 2129-2258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000518
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 17 Region: 649-719
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000602
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 18 Region: 2571-2687
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 723-849
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 20 Region: 1153-1198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000165
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 21 Region: 2008-2055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000271
Family EGF-type module 0.005
Further Details:      
 
Domain Number 22 Region: 1604-1653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000276
Family EGF-type module 0.00042
Further Details:      
 
Domain Number 23 Region: 1765-1814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000044
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 24 Region: 1966-2010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 25 Region: 1481-1528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000234
Family EGF-type module 0.00018
Further Details:      
 
Domain Number 26 Region: 284-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 27 Region: 1439-1487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000324
Family EGF-type module 0.007
Further Details:      
 
Domain Number 28 Region: 2406-2450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000345
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 29 Region: 2284-2333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000399
Family EGF-type module 0.007
Further Details:      
 
Domain Number 30 Region: 1808-1844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000345
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 31 Region: 1646-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000341
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 32 Region: 2247-2289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000926
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014017
Domain Number - Region: 150-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00283
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 116-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0949
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014017   Gene: ENSPANG00000017748   Transcript: ENSPANT00000025456
Sequence length 2871
Comment pep:known_by_projection chromosome:PapAnu2.0:7:22677432:22915684:-1 gene:ENSPANG00000017748 transcript:ENSPANT00000025456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGGLLEIFLGFTVLLASYTSHGADTNLEAGNVKETRASRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCN
IRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGICD
GGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCC
DAGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGPIPPVLPVPPGFP
PGPQIPVPRPPVEYPYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTPGSYRCECNKGF
QLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRI
CNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKP
GFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST
CYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSA
GSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQ
CRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDP
TKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGY
SRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFL
RYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEIT
NGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDL
CGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCEC
PPGHQLSPNISACIDINECELSAHLCPNGRCVNLIGKYQCTCNPGYHSTPDRLFCVDIDE
CSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGE
YRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGC
TDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADC
KNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCGNGQCLNAPGGYRCECDMGFVPSAD
GKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCISG
NCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVSKA
SCCCSLGKAWGTPCEMCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQGG
KCINTFGSFQCRCPTGYYLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICPPDYMQ
VNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQCPIPS
TDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPVGFFYN
DKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRFTSTGQCNDRNECQEIPNIC
SHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHGF
ILSHNNDCIDVDECASGNGNLCRNGQCINTVGSFQCQCNEGYEVAPDGRTCVDINECLLE
PRKCAPGTCQNLDGSYRCICPPGYSLQDDKCEDIDECVEEPEICALGTCSNTEGSFKCLC
PEGFSLSSSGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCP
TEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILA
GNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFR
CVNTYGSYECKCPVGYVLREDRRMCRDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGY
QRRPDGEGCVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPNQDECLDNREGYCF
TEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG
ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPCNFICK
NTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHT
ACIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQTGSSCEDVDECEGNHRCQHG
CQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPAGFQYE
QFSGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMGRGNPEPP
VSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETDASNIEDQSETEANVSLASWDVEK
TAIFAFNISHISNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKK
KPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH
Download sequence
Identical sequences A0A096NM08 A0A2K6BW09
XP_011754875.1.29376 ENSPANP00000014017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]