SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014125 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014125
Domain Number 1 Region: 16-120
Classification Level Classification E-value
Superfamily PX domain 1.31e-22
Family PX domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014125   Gene: ENSPANG00000016815   Transcript: ENSPANT00000002119
Sequence length 193
Comment pep:known_by_projection chromosome:PapAnu2.0:7:38363528:38367070:1 gene:ENSPANG00000016815 transcript:ENSPANT00000002119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEVHIPSVGPEAEGPRQSPEKGHMVFQVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKV
PDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWG
ALGEFLPGESSSQQHQRPVLSFHMDPYVCTPSPELLPNVVVNGVLQGLYSFSISPDKAQP
KAACHPAPLPPMP
Download sequence
Identical sequences A0A096NMB6 A0A2K5VCI2 A0A2K6BXP0 H9FZX9
ENSPANP00000014125 NP_001244637.1.72884 XP_005559823.1.63531 XP_011751394.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]