SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014228 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014228
Domain Number 1 Region: 115-411
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-64
Family Nuclear receptor ligand-binding domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 45-130
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.07e-29
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014228   Gene: ENSPANG00000016257   Transcript: ENSPANT00000003791
Sequence length 411
Comment pep:known_by_projection chromosome:PapAnu2.0:7:46282766:46288864:1 gene:ENSPANG00000016257 transcript:ENSPANT00000003791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNTRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTAGVSPSLQCRVCGDSSSGKHY
GIYACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQ
NERQPRSTAQVRLDSMESSTEPRPEPLVAPPTPAGPSPRGPTPMSAARALGHHFMASLIT
AETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLP
VFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASME
TRVLRETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKA
HHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences ENSPANP00000014228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]