SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014287 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014287
Domain Number 1 Region: 33-209
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.44e-58
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014287   Gene: ENSPANG00000015962   Transcript: ENSPANT00000004822
Sequence length 221
Comment pep:known_by_projection chromosome:PapAnu2.0:7:49552405:49575009:1 gene:ENSPANG00000015962 transcript:ENSPANT00000004822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRPGRLPELEATRPHMEPKASCPTAAPLVERKFHVLVGVTGSVAALKLPLLVSKLLDI
PGLEVAVVTTEGAKHFYSPQDIPVTLYSDADEWEMWKSRSDPVLHIDLRRWADLLLVAPL
DANTLGKVASGICDNLLTCVIRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVE
IPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS
Download sequence
Identical sequences A0A096NMS7
ENSPANP00000014287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]