SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014312 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014312
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily EF-hand 1.9e-27
Family Calmodulin-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014312   Gene: ENSPANG00000015842   Transcript: ENSPANT00000009973
Sequence length 188
Comment pep:known_by_projection chromosome:PapAnu2.0:7:52499429:52524285:-1 gene:ENSPANG00000015842 transcript:ENSPANT00000009973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTIFTEEQLDNYQQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLI
IQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNT
DNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDF
LSTFHIRI
Download sequence
Identical sequences ENSPANP00000014312 ENSGGOP00000010676 ENSGGOP00000010676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]