SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014394 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014394
Domain Number 1 Region: 39-89
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000135
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 454-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000913
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 685-740
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000131
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 503-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000299
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 593-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000983
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 547-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000406
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 748-772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000411
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014394
Domain Number - Region: 97-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00428
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014394   Gene: ENSPANG00000020637   Transcript: ENSPANT00000018980
Sequence length 856
Comment pep:known_by_projection chromosome:PapAnu2.0:10:313866:319659:1 gene:ENSPANG00000020637 transcript:ENSPANT00000018980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVVRGGQTVPGQAPLCFDPGSPASDKTEGKKKGRPKAENQALRDIPLSLMNDWKDEFKA
HSRVKCPNSGCWLEFPSIYGLKYHYQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIW
NHMDRPLPASKPGPISRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVSVGRP
MPVTKAMPVTRPVPVTKPVTVSRPMPVTKAMPVTRPVPVTKPITVTKSVPVTKPVPVTKP
ITVTKLVTVTKPVPVTKPVTVSRPIVVSKPVTVSRPIAISRHTPPCKMVLLTKSENKAPR
ATGRNSGKKRAADGLDTCPIPPKQARPENGEYGPSTVGQSSAFQLSADASSGSLSPGSRP
SGGVEALRAAGPASPPEEDPERTKHRRKQKTPKKFTGEQPSISGTFGLKGLVKAEDKARV
HRSKKQEGPGPEDARKKVPAPITVSKEAPAPMAHPAPGGPEEQWQRAIHERGEAVCPTCN
VVTRKTLVGLKKHMEVCQKLQDALKCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEASEGG
EQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCG
KTYRSKAGHDYHVRSEHTAPPPEEPTDKSPEAEDLLGVERTPSGRVRRTSAQVAVFHLQE
IAEDELARDWTKRRMKDDLVPETARLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDC
CEAIYSSVSGLKAHLASCSKGAHLAGKYHCLLCPKEFSSESGVKYHILKTHAENWFRTSA
DPPPKHRSQDSLVPKKEKKKNLAGGKKRGRKPKERPPEEPVAKLPPRRDDWPLGCKDKGA
RGSTGRKVGASKAPEK
Download sequence
Identical sequences ENSPANP00000014394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]