SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014484 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014484
Domain Number 1 Region: 3516-3690
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-25
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 3324-3505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.55e-24
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 3119-3290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.01e-17
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 4 Region: 2938-3112
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000528
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 5 Region: 2731-2912
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000302
Family Laminin G-like module 0.034
Further Details:      
 
Domain Number 6 Region: 1919-1969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000642
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 7 Region: 1967-2021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000921
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 8 Region: 539-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 9 Region: 357-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 10 Region: 1575-1623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000212
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 11 Region: 675-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 12 Region: 1436-1484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 13 Region: 1862-1913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000364
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 14 Region: 1526-1577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 15 Region: 740-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 16 Region: 774-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.0038
Further Details:      
 
Domain Number 17 Region: 585-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 18 Region: 298-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000195
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 19 Region: 630-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 20 Region: 2076-2116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 21 Region: 2020-2069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 22 Region: 427-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000165
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 23 Region: 492-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 24 Region: 827-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014484
Domain Number - Region: 1825-1864
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family Laminin-type module 0.079
Further Details:      
 
Domain Number - Region: 103-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00468
Family APC10-like 0.038
Further Details:      
 
Domain Number - Region: 2198-2256
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0785
Family SNARE fusion complex 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014484   Gene: ENSPANG00000025595   Transcript: ENSPANT00000006656
Sequence length 3691
Comment pep:known_by_projection chromosome:PapAnu2.0:10:1960777:2019979:1 gene:ENSPANG00000025595 transcript:ENSPANT00000006656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRLCAGSALCVRGPRGPAPLLLVGLALLGTARAREEAGGGFSLHPPYFNLAEGARIAA
SATCGEEAPARGEPRSPGRLLPQSAGGGGGPCSLSLQGQYCDICTAANSNRAHPASNAID
GTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGRTY
QPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENGEIVVSLVNGRPGAM
NFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRCVC
HGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKSTSSRTCVSCPPCNCH
GHATDCYYDPEVDQRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPDHPLDS
PHVCRRCNCESNFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYLTPSSSNDTR
EQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCVCKPNFQGTHCELCVPGFYGPGCQPCQ
CSSPGVADDRCDPDTGRCRCREGFEGATCDRCAPGYFRFPLCQLCGCSPAGTLPEGCDEA
GRCPCQPGFAGPHCDQCHPGYHGFPNCQPCTCDPRGALDQLCGAGGLCRCRPGYTGTACQ
ECSPGFHGFPSCVPCHCSAEGSLHAACDPRSGQCSCRPRVTGLRCDTCVPGAYNFPYCEA
GSCHPAGLALVDPALPEAQAPCVCRANVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDPRG
TLGGVAECQPGTGQCFCKPHVCGQACAACRDGFFGLDQADYFGCRSCRCDAGGALGQSCE
PRTGACRCRPNTQGPTCSRPVRDHYVPDLHHLRLELEEAATPEGHAVRFGFNPLEFENFS
WRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSAACANCTA
QSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGTWALLVEAEGVLLDYVVLLPSAYYEAAL
LQLRVTEACTYRPSTQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQLSP
SHPPLVTCTGSDVDVQLQVAVPQPGRYALVVEYANEDARQEVGVAVHTPQRAPQQGLLSL
HPCLYSTLCRGTARDTQDRLAVFHLDSEASVRLTAEQARFYLHGVTLVPMEEFSPEFVEP
RVRCISSHGAFGPSSAACLPSRFPKPPQPIILRDCQVIPLPPGLPLTHAQDLTPATSPTG
PQPRPPTAVDPDVEPTLLREPQATVVFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLINAG
RVWQGHANASFCPHGYGCRTLVVCEGQALLDVTHSELTVTVRVPEGRWLWLDYVLVVPEN
VYSFGYLREEPLDKSYDFISHCAAQGYHISPSSSSLFCRNAAASLSLFYNNGARPCGCHE
VGATGPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTGQCICPP
RTVPPECLLCQPQTFGCHPLVGCEECNCSGPGVQELTDPTCDTDSGQCKCRPNVTGRRCD
TCSPGFHGYPHCRPCDCHEAGTAPGVCDPLTGQCYCKENVQGPRCDQCSLGTFSLDAANP
KGCTRCFCFGATERCRSSSYTRQEFVDMEGWVLLSIDRQVVPHERRPGSEMLRADLRHVP
EAVPEAFPELYWQAPPSYLGDRVSSYGGTLRYELHSETQRGDVFVPTESRPDVVLQGNQM
SITFLEPAYPMPGHIHRGQLQLVEGNFRHTETRNTVSREELMMVLASLEQLQIRALFSQI
SSAVSLRRVALEVASPAGQGTLASNVELCLCPASYRGDSCQECAPGFYRDVKGLFLGRCV
PCQCHGHSDRCLPGSGICVDCQHNTEGAQCERCQAGFVSSREDPSAPCVSCPCPLSVPSN
NFAEGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNLLFS
DDPLTGACRGCLRHTTGPRCEICAPGFYGNALLPGNCTRCDCAPCGTEACNPHSGQCLCK
AGVTGRRCDRCQEGHFGFEGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTMGPQCRECA
PGYWGLPEQGCRRCQCPGGRCDPHTGRCTCPPGLSGERCDTCSQQHQVPVPGGPGDHSVH
CEVCDHCVVLLLDDLERAGTLLPAIREQLRGINASSVAWARLHRLNASITDLQSQLRSPL
GPRHETAQQLEVLEQQSTSLGQDAQQLDSQATGTREQASRLLAGTEATLGRAKTLLAAIR
AVDRTLSELMSQTGHLGLANASALSGEQLRRTLAEVERLLWEMRARDLGAPRAAAEAELA
AAQRLLARVQEQLSSLWEENQALATHTRDRLAQHEAGLMDLREALNRAVDATREAQELNS
RNQERLEEALQRKQELSRDNATLKATLHAANDTLASVFRLLHSLDQAKEELERLAASLDG
ARTPLLQRMQSFSPAGSKLRLVEAAEAHAQQLDQLALNLSSIILDINQDRLTQRAIEASS
AYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRARQLLANSSALEEAVLREQRRL
GLVWAALQGAGTQLRDVRAKKDQLEARIQAAQAMLAMDTDETSKKIAHAKAVAAEAQDMA
ARVQSQLQAMQESVERWQGQYEGLRGQDLGQAVLDAGRSVSSLEKTLPQLLAKLSVLENR
GAHNASLVLSASIGRVRQLIAQARGAASKVKVPMKFNGRSGVQLRTPRDLADLAAYTALK
FYLQGPEPEPGQGTEDHFVMYMGSRQATGDYMGVSLRDKKVHWVYRLGEAGPAVLSIDED
IGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPS
TFTPPPLLRFPGYRGCIEMDTLNEEVVSLYNFERTFQLDTAVDRPCARSKSTGDPWLTDG
SYLDGTGFARISFDGQISTTKRFEQELRLVSYSGVLFFLKQQSQFLCLAVREGSLVLLYD
FGAGLREAVPLQTPPPLTSASKAIQVFLLGGSRKRVLVRVERATVFSVEQDNALELADAY
YLGGAPPDQLPPSLRRLFPMGGSVRGCVKGIKALGKYVDLKRLNTTGVSAGCTADLLVGR
AMTFHGYGFLHLALSNVAPLTGDVYSGFGFHSAQDSALLYYRASPDGPCQVSLRQGHVTL
QLLRTEVIAEGGFADGAPHYVAFYSNATGVWLYVDDQLQQMKPHQGPPSEPQPQPEGPPS
LLLGGLPEPDTFHFSGCISNIFVRRLLGPQRVFDLQQNLGSVNVSTGCAPTLQAQTVDLG
PRGLRTTARKASRRSRQPTQDPACMLPPHLRTTRDTYQFGGSLSSHLEFVGILAPHRNWP
SLSMRVLPRSPRGLLLFAASLRPSSPSLALFLSNGHFVAQMEGLGTRLRAQSRQRSWPGH
WHKVSVRWEKNRILLVTDGARAWSQEGPRWQHQGAEHPQPHTLFVGGLPASNHSSKLPVT
VGFSGCVKRLRLHGRPLGAPTRMAGVTPCISGPLEAGLFFPGSGGVITLDLPGATLPDVG
LELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQ
WHRLAVMKGGNVLRLEVDAQSNHTVGPSLAAAAGAPAPLHLGGLPEPTAMQPWPPAYRGC
MRRLTVNRAPVTITRSAEVHGAVGASGCPAA
Download sequence
Identical sequences ENSPANP00000014484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]