SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014760 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014760
Domain Number 1 Region: 1125-1253
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-30
Family Cadherin 0.00099
Further Details:      
 
Domain Number 2 Region: 3315-3426
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 2790-2898
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 4 Region: 2266-2371
Classification Level Classification E-value
Superfamily Cadherin-like 9.29e-28
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 3005-3113
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-27
Family Cadherin 0.00089
Further Details:      
 
Domain Number 6 Region: 3719-3901
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-27
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 7 Region: 808-924
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-26
Family Cadherin 0.0009
Further Details:      
 
Domain Number 8 Region: 3414-3537
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 1018-1136
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-25
Family Cadherin 0.00069
Further Details:      
 
Domain Number 10 Region: 2058-2165
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 11 Region: 1543-1652
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-24
Family Cadherin 0.00076
Further Details:      
 
Domain Number 12 Region: 3102-3213
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-23
Family Cadherin 0.0047
Further Details:      
 
Domain Number 13 Region: 719-812
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-22
Family Cadherin 0.0023
Further Details:      
 
Domain Number 14 Region: 446-545
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 15 Region: 2900-3011
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-21
Family Cadherin 0.0042
Further Details:      
 
Domain Number 16 Region: 918-1023
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-21
Family Cadherin 0.0025
Further Details:      
 
Domain Number 17 Region: 1752-1872
Classification Level Classification E-value
Superfamily Cadherin-like 3e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 18 Region: 2475-2585
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 19 Region: 1438-1548
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-20
Family Cadherin 0.0024
Further Details:      
 
Domain Number 20 Region: 136-226
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-20
Family Cadherin 0.003
Further Details:      
 
Domain Number 21 Region: 2165-2272
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-19
Family Cadherin 0.0025
Further Details:      
 
Domain Number 22 Region: 1230-1338
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-19
Family Cadherin 0.0064
Further Details:      
 
Domain Number 23 Region: 2373-2481
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-19
Family Cadherin 0.0018
Further Details:      
 
Domain Number 24 Region: 1648-1766
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-18
Family Cadherin 0.0023
Further Details:      
 
Domain Number 25 Region: 2573-2681
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-18
Family Cadherin 0.0031
Further Details:      
 
Domain Number 26 Region: 3213-3314
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-17
Family Cadherin 0.0022
Further Details:      
 
Domain Number 27 Region: 2688-2797
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000002
Family Cadherin 0.0022
Further Details:      
 
Domain Number 28 Region: 557-658
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000615
Family Cadherin 0.0019
Further Details:      
 
Domain Number 29 Region: 1860-1981
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000885
Family Cadherin 0.0035
Further Details:      
 
Domain Number 30 Region: 1966-2070
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000214
Family Cadherin 0.0023
Further Details:      
 
Domain Number 31 Region: 1349-1434
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000196
Family Cadherin 0.008
Further Details:      
 
Domain Number 32 Region: 362-458
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000101
Family Cadherin 0.0069
Further Details:      
 
Domain Number 33 Region: 3528-3619
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000017
Family Cadherin 0.016
Further Details:      
 
Domain Number 34 Region: 32-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000565
Family Cadherin 0.0081
Further Details:      
 
Domain Number 35 Region: 3904-3942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000367
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 36 Region: 3944-3984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000514
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014760   Gene: ENSPANG00000003561   Transcript: ENSPANT00000006626
Sequence length 4305
Comment pep:known_by_projection chromosome:PapAnu2.0:6:145028619:145115454:-1 gene:ENSPANG00000003561 transcript:ENSPANT00000006626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIALLGFAIFLLHCATCEKPLEGILSSSAWHFTHSHYNATIYENSSPKTYVESFEKMGI
YLAEPQWAVRYRIISGDVANAFKTEEYVVGNFCFLRIRTKSSNTALLNREVRDSYTLIIQ
ATEKTLELEALTRVVVHILDQNDLKPLFSPPSYRVTISEDMPLKSPICKVTATDADLGQN
AEFYYAFNTRSEMFAIHPTSGVVTVAGKLNVTWRGKHELQVLAVDRMRKISEGDGFGSLA
ALVIHVEPALRKPPAIASVVVTPPDSNDGTTYATVLVDANSSGAEVESVEVVGGDPGKHF
KAIKSYARSNEFSLVSVKDINWMEYLHGFNLSLQARSGSGPYFYSQIRGFHLPPSKLASL
KFEKAVYRVQLSEFSPPGSRVVMVRVTPAFPNLQYVLKPSSENVGFKLNARTGLITTTKL
MDFHDRAHYQLHIRTSPGQVSTMVVIDIVDCNNHAPIFNRSSYDGTLDENIPPGTSVLAV
TATDRDHGENGYVTYSIAGPKALPFSIDPYLGIISTSKPTDYELMKRIYTFRVRASDWGS
PFRREKEVSIFLQLRNLNDNQPMFEEVNCTGSIHQDWPVGKSIVTMSAIDVDELQNLKYE
IISGNELEYFDLNHFSGVISLKRSFINLTAGQPTSYSLKITASDGKNYASPTTLNITVVK
DPHFEVPVTCDKTGVLTQFTKTILHSIGLQNQESSDEEFTSLSTYQINHYTPQFEDHFPQ
SIDVLESVPINTPLARLAATDPDAGFNGKLVYVIADGNEEGCFDIELETGLLTVAAPLDY
EVTNFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQLTISEDTEVGTTIA
ELTTKDADSEDNGRVRYTLLSPTEKFSLHPLTGELVVTGHLDRESEPRYILKVEARDQPS
KGHQLFSVTDLIITLEDVNDNSPQCITERNRLKVPEDLPPGTVLTFLDASDPDLGPAGEV
RYVLMDGAHGTFRVDLMTGALILERELDFERRAGYNLSLWASDSGRPLARRTLCHVEVIV
LDVNENLHPPHFASFVHQGQVQENSPSGTQVMVVAAQDDDSGLDGELQYFLRAGTGLAAF
SINQDTGMIQTLAPLDREFASYYWLTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQA
VFYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNITSGNHMGFFIIHPVTGLLSTARQL
DRENKDEHILEVTVLDNGEPSLKSTSRVVIGILDVNDNPPVFSHKLFNVRLPERLSPVSS
GPVYRLVASDLDEGLNGRVTYSVKESDEEGFSIDPVTGVVSSSSTFTAGEYNILTIKATD
SGQPPLSASVRLHIEWIPQPRPSSIPLAFDETHYSFTVMETDPVNHMVGVISVEGRPGLF
WFNISGGDKDMDFDIEKTTGSIVIARPLDTRRRSSYNLTVEVTDGSRTIATQVHIFMIAN
INHHRPQFLETRYEVRVPQDTVPGVELLRVQAIDQDKGKSLIYTIHGSQDPGSASLFQLD
PSTGVLVTVGKLDLGSGPSQHTLTVMVRDQEIPIKRNFVWVTIHVEDGNLHPPRFTQLHY
EASVPDTIVPGTELLQVRAMDADRGVNAEVHYSLLKGNGEGFFNINALLGIITLAQKLDR
ANHAPHTLTVKAEDQGSPQWHDLATVIIHVYPSDRSTPIFSKSEYFVEIPESIPVGSPIL
LVSAMSSSEVTYELREGNKDGVFSMNSYSGLISTQKNLDHEKISSYQLKIRGSNMAGAFT
DVMVVVDIIDENDNAPMFLKSTFVGQISEAAPLYSMIMDKNNNPFVIHASDSDKETNSLL
VYKILEPEALKFFKIDPSMGTLTIVSEMDYESMPSFQFCVYVHDQGSPILFAPRPAQVII
HVRDVNDSPPRFSEQIYEVAIVGPIHPGMELLMVRASDDDSEVNYSIKTGNADEAVTIHP
ITGSISVLNPAFLGLSRKLTIRASDGLYQDTALVKISLTQVLDKSLQFDQDVYTAAVKEN
LQDRKALVILGVQGNHLNDTLSYFLLNGTDMFHMVQSAGVLQTRGVAFDREQQDTHELAV
EVRDNRTPQRVAQALVRVSIEDVNDNPPKFKHLPYYTIIQDGTEPGDVLFQVSATDEDLG
TNGAVTYEFAEDYTYFRIDPYLGDITLKKPFDYQALNKYRLKVIAQDGGTPSLQSEEEVL
VTVRNKSNPLFQSPYYKVRVPENITLYTPILHTQARSPEGLRLIYNIVEEEPLMLFTTDF
KTGVLTVTGPLDYESKTKHVFTVRATDTALGSFSEATVEVLVEDVNDNPPTFSQLVYTTS
ISEGLPAQTPVIQLLASDRDSGQNRDVSYQIVEDGSDVSKFFQINGSTGEMSTVQELDYE
AQQHFHVKVRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGHLVLK
VQAIDPDSRDTSRLEYLILSGNQDRHFSINSSSGIISMFNLCKKHLDSSYNLRIGASDGV
FRATVPVYINTTNVNKYSPEFQQHLYEAELAENAMVGTKVIDLLAIDKDSGPYGTVDYTI
INKLASEKFSINPNGQIATLQKLDRENSTERVIAIKVMARDGGGRVAFCTVKIILTDEND
NPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEGQNADVTYSMNPEDLVKDVIEINPVT
GVVKVKDSLVGLENQTLDFFIKAQDGGPPHWNSLVPVRLQVVPKKVSLPKFSEPLYTFSA
LEDLPEGSEIGVVKAVAAQDPVIYSLVRGTTPESNKDGVFSLDPDTGVIKVRKPMDHEST
KLYQIDVMAHCLQNSDVVSLVSVNIQVGDVNDNRPVFEADPYKAVLTENMPVGTSVIQVT
AIDKDTGRDGQVSYRLSADPGSNVHELFAIDSESGWITTLQELDCETCQTYHFHVVAYDH
GQTIQLSSQALVQVSITDENDNAPRFASEEYRGSVVENSEPGKLVVTLKTLDADISEQNR
QVTCYITEGDPLGQFGISQVGDEWRISSRKTLDREHTAKYLLRVTASDGKFQASVTVEIF
VLDVNDNSPQCSQLVYTGKVHEDVFPGHFILKVSATDLDTDTNAQITYSLHGPGAHEFKL
DPHTGELTTLTALDRERKDVFNLVAKATDGGGRSCQADVTLHVEDVNDNAPRFFPSHCTV
AVFDNTTVKTPVAVVFARDPDQGANAQVVYSLPDSAEGHFSIDATTGVIRLEKPLQVRPQ
APLELTVRASDLGTPISLSTLGTVTVSVVGLEDYLPVFLNTEHSVQVPEDAPPGTEVLQL
ATLTRPGAEKTGYRMVGGNEQGRFRLDARTGILYVNASLDFETSPKYFLSIECSRKSSSS
LSDVTTVVVNITDVNEHRPQFPQDPYSTRVLENALVGDVILTVSATDEDGPLNSDITYSL
IGGNQLGHFTIHPKKGELQVAKALDWEQASSYSLKLRATDSGQPPLHEDTDITIQVADVN
DNPPRFFQLNYSTTVQENSPIGSKVLQLILSDPDSPENGPPYSFRITKGNDGSAFRVTPD
GWLVTAEGLSRRAQEWYQLQIQASDSGIPPLSSSTSVCVHVTEQSHYAPSALPLEIFITV
GEEEFQGGMVGKIHATDRDPQDMLTYSLAEEETLGRHFSVGAPDGKIIAAQGLPRGRYSF
NVTVSDGTFTTTAGVHVYVWHAGREALQQAMWMGFYQLTPEELGHSGTFYEFQELASIIT
HSAKEMEHSVGVQMRSAMPVVPCQGPTCQSQICHNTVHLDPKVGPTYSTARLSILTPRHH
LHRSCSCNGTAARFSGQSYVRYRAPAARNWHIRFYLKTLQPQAILLFTNETASISLKLVS
GVPQLEYHCRGGFYGNLSSQRHVNDHEWHSILVEEMDASIRLMIDSMGNTSLVVPENCRG
LRPERHLLLGGLVLSHSSSNVSQGFEGCLDAVMVNEEALDLLVPGKTVAGLLETQALTQC
CLHSDYCSQNPCLNGGKCSWTHGAGYVCKCPPHFSGKHCEQGRENCTFAPCLEGETCILS
PKGASCNCPHPFTGDRCEMEARGCSEGHCLVTPEITRGDWGQQELLIIIVAVVLIIISTV
GLLLYCRRCKSHKPVAMEDPDLLARSVGVDTQAIPAIELNPLTASSCNNLNQPEPSKTSL
PNELVTFGPNSKQRPVVCSVPPRLPPAAVPSHSDNEPVIKRTWSGEEMVYPGGAMVWPPT
YSRNERWEYPHSEVTQGPLPPSAHRHSTPVVMPEPTGLYGGFPFPLEMENKRAPLPPRYS
NQNLEDLMPSRPPSPRERLVAPCLNEYTAISYYHSQFRQGGGGPCLAEGGYKGMSMRLSR
AGPSYAVCEAEGAPLAGQGQHRAPPNYEGSDMVESDYGSCEEVMF
Download sequence
Identical sequences A0A096NP43
ENSPANP00000014760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]