SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014912 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014912
Domain Number 1 Region: 329-403
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000981
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 127-202
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000126
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 964-1053
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000165
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 4 Region: 883-954
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00001
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014912
Domain Number - Region: 442-491
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00177
Family Carboxypeptidase regulatory domain 0.019
Further Details:      
 
Domain Number - Region: 810-868
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00294
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 215-299
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00333
Family Rhamnogalacturonase B, RhgB, middle domain 0.02
Further Details:      
 
Domain Number - Region: 51-115
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00785
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014912   Gene: ENSPANG00000009405   Transcript: ENSPANT00000012138
Sequence length 1222
Comment pep:novel chromosome:PapAnu2.0:20:15180813:15248107:1 gene:ENSPANG00000009405 transcript:ENSPANT00000012138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGQGAGPSGPAVVAAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGG
DINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
YEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSS
LVTKEDVLGCNVSPVPGFQHQDESLVYLCYTVSREDGSFSFYSLPSGGYTVIPFYRGERI
TFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISIIRFP
DTVKQMSKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLK
PQMFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NSMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAI
TLEFYQDGNGRENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILT
LTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGKEEGEERMTKPPVQEMVDELQGPFLYDFSYWARSGEKITVTPSSKELLFYPPSME
AIVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSV
GPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGG
VFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTA
YSCYGTVSSLNGEPEQGVAVEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKA
EGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKH
ITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQA
ASDNSGPEDAKRQAKKQKTRRT
Download sequence
Identical sequences A0A096NPI2
ENSPANP00000014912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]