SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014927 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014927
Domain Number 1 Region: 559-834
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000192
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number 2 Region: 172-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000194
Family EGF-type module 0.017
Further Details:      
 
Domain Number 3 Region: 80-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 130-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000516
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 33-69
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000063
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014927   Gene: ENSPANG00000000239   Transcript: ENSPANT00000008921
Sequence length 847
Comment pep:known_by_projection chromosome:PapAnu2.0:19:6638529:6690081:1 gene:ENSPANG00000000239 transcript:ENSPANT00000008921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGFNLLLFWGCCVMHSWERHTGPTLKPTTKDNKCRDSTMCPSHATCTSTVDSYYCACKQ
GFRSSNGQNHFKDPGVECKDVDECSESQPCGPNSVCKNLSGRYECSCLRGFSSPTGNNWK
PGKPGNFSCTDINECLTGRVCPEHSDCVSSMGSYNCNCQVGFISRNSICLSDDNECANPR
MCPEHATCNNTVGNYSCFCDPGFESSSGHLSFQGLKCEGRWGCRLRNQVQDCLQRQHLRL
SSANLKPIIIHSLMCXAGFRPNPESSQKDGNFSCQRVPFKCKEDVIPDNEQVQQCQERTT
VKREYVSFCAQINNIFSVLDNVCENKTTVVSLKNTTESFVPVLKQISTWTKFTKEETSSL
ATVLLESVESLTLAAFLKPSANVTQTVRTDYLDIESKVINKECSEENVNLSLAAKGDKMK
IRCSTIEESESTGTTGVAFVSFVGVESVLNERFFQDHQAPLTTSKIKLKMNSRVVGGIMT
GEKKDGFSDPVIYTLENIQPKQEFERPICVSWSTGINGIEEELSLSCSTPEVGAFLNVCG
GCQLIAKITVLPTWGNFDMDFYLYVISHVGMIISLVCLVLAIATFLLCRSIRNHITYLHL
HLCVCLLLAKILFLAGIDKTDNQTGCAIIAGFLHYLFLACFFWMLVEAVMLFLMVRNLKV
VNYFSSRNIKMLHICAFGYGLPVLVVVISASVQSQGYGMHNRCWLNTETGFIWSFLGPVC
TVIAINSILLTWTLWILRQRLSSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGILQIG
PVAGVMAYLFTIINSLQGAFIFLIHCLLNHQVREEYKRWITGKMKPSSQSQTSSILLSSM
PSTSKTG
Download sequence
Identical sequences ENSPANP00000014927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]