SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015083 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015083
Domain Number 1 Region: 984-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000347
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 950-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000576
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015083
Domain Number - Region: 1114-1206
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000392
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015083   Gene: ENSPANG00000006172   Transcript: ENSPANT00000023223
Sequence length 1345
Comment pep:known_by_projection chromosome:PapAnu2.0:2:44454162:44539768:-1 gene:ENSPANG00000006172 transcript:ENSPANT00000023223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQTSGKSYAASDAPENLTLLAETAEARGRNGSSSRTNFTNLPVGYSLEIATALTSQSST
LASESLHLPSSSSEFDERIAPFQTKSGTALEMGTERLMGLSEEVTVHSQEATTSAWSPSS
LHALEMGELTMPSRKRNSSGPDLSWMHFYRTAASSPLSDHSSSSESTEKLNSSTGLQSSS
VHQTKTMHAATVFTDGGPRTLRSLTVSLGPVSKTEGFPKDSKIATTSASVHLSPSAVESR
RNSRVTGNPADGEFIEPSTENEFGRTSLHWQNDSPTFGEHQLASSSDVQNGSPMSQTETV
SRSVAPTRGGASTEHWLLTNSTTSADVTGSSASYPEGVNASVLTHFSDSTVQSGGSHTAL
GDRNYSESSSTSSSESLNSSAPRGERSTLEDSQEPGQALGDSSANAEDRTSGVPSPGTHT
LATVTGNGERTLRSITLTNTSMSMTSGEAGSHAATMPQETESASLHVNVTDDMGLVSRSL
AASSALGVTGISYGQVSGTATEQRTSSDHTDHTYLSSTFTKGERALLSITDNSSSSDIVE
SSTSYIKISNSSHSDYSSFSHTQTERSNISSYDGEYAQPSTESPVLHTSNLPSYTPTINM
PNTSVVLDTDAEFVSDSSSSSPSSSSSSSSSSSSSSRPPLPLPSVSQSHHLFSSILPSTG
ASVHLLKSTSDAFTLLSSSPSPLPVSLTTSTSAPLSVSQTTLPQSSSTPVLPRVTETPVT
SVQTSTMTSFMTMLHSSQTADLKNRSTPHQEKVITESKSPSLVSLPTESTKAITTSSPLP
PSLTESSTEQTLLATSANLAQMSPAFTTTILKTSHPLRTTPGTLSSTASLVTGLIAIQTT
AGKQLSLTHPEILVPHISTEGGISTERNQVNVDATTGLIPLTSIPTSAKELTTKLGVTAE
YSPASHSLGTSPSPQTTVVSTAEALAPKSATFAVQSSTQSPTTLSSSASVNSCATNPCLH
DGECIADNTSRGYHCRCPPSWQGDDCSVDVDECLSNPCPSTATCNNTQGSFICKCPVGYQ
LEKGICNLVRTFVTEFKLKRTFLNTTVEKHSDLQGVENEITKTLNMCFSALPSYIRSTVH
ASRESNAVVISLQTTFSLASNVTLFDLADRMQKCVNSCKSSAEVCQLLGSQRRIFRAGSL
CKRKSPECDKDTSICTDLDGVALCQCKSGYFQFNKMDHSCRACEDGYRLENETCMSCPFG
LGGLNCGNPYQLITVVIAAAGGGLLLILGIALIVTCCRKNKNDISKLIFKSGDFQMSPYA
EYPKNPRSQEWGREAIEMHENGSTKNLLQMTDVYYSPTSVRNPELERNGLYPAYTGLPGS
RHSCIFPGQYNPSFISDESRRRDYF
Download sequence
Identical sequences ENSPANP00000015083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]