SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015207 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015207
Domain Number 1 Region: 72-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.33e-48
Family Regulator of G-protein signaling, RGS 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015207   Gene: ENSPANG00000016200   Transcript: ENSPANT00000011839
Sequence length 209
Comment pep:known_by_projection chromosome:PapAnu2.0:1:171723964:171731460:-1 gene:ENSPANG00000016200 transcript:ENSPANT00000011839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAAISTPKLDKMPGMFFSANPKELKGTAHSLLDDKMQKRRPKTFGMDMKAYLRSMIPH
LESGMKSSKSKDILSAAEVMQWSLSLEKLLANQTGQKVFGSFLKSEFSEENIEFWLACED
YKKTESDLLPCKAEEIYKVFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYT
LMEKDSYPRFLKSDIYLNLLNDLQANSLK
Download sequence
Identical sequences A0A096NQB3 A0A2K5YYZ2 A0A2K6CZI9 G7MF14 G7NXE3
ENSPANP00000015207 XP_011744745.1.29376 XP_011850472.1.47321 XP_011927113.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]