SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015220 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000015220
Domain Number - Region: 490-576
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0268
Family Di-heme elbow motif 0.071
Further Details:      
 
Domain Number - Region: 624-649
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0627
Family A20-like zinc finger 0.051
Further Details:      
 
Domain Number - Region: 675-712
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0641
Family A20-like zinc finger 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015220   Gene: ENSPANG00000007076   Transcript: ENSPANT00000016225
Sequence length 804
Comment pep:known_by_projection chromosome:PapAnu2.0:4:124606984:124621726:-1 gene:ENSPANG00000007076 transcript:ENSPANT00000016225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFFSFPFQVLESTMAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRY
TLEMFRTCQFCPQFREIIHKALIDKNIQASLESQKKLNWCREVRKLVALKTNGDGNCLMH
ATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWND
EWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAP
LKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDL
KVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYF
ELVQHEYKKWQENSEQGRREMHAQNPMESSLPQLSLMDVKCETPNCPFFMSVNTQPLCHE
CSERRQKNQNKLPKLNSKPGPEGLPGMALGASRGEAYEPLAWNPEEPTGGPHSAPPTAPS
PFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAADHTRHLDPGKCQACLQ
DVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSQLVRSPSPHSCHRAGNDA
PAGCLSQAARTPGDRTGTSKCRKAGCMYFGTPENKGFCTLCFIEYRENKHLVAASGKASP
TASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPR
TTQSTSRPKCARASCKNILACRSEELCMECQHPNPRMGPGAHRGEPAPEDPPKQRCRAPA
CDHFGNAKCNGYCNECFQFKQMYG
Download sequence
Identical sequences A0A096NQC6
ENSPANP00000015220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]