SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015326 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015326
Domain Number 1 Region: 510-769
Classification Level Classification E-value
Superfamily NHL repeat 5.23e-47
Family NHL repeat 0.00000725
Further Details:      
 
Domain Number 2 Region: 360-456
Classification Level Classification E-value
Superfamily E set domains 1.67e-22
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 136-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 45-119
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000442
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015326   Gene: ENSPANG00000023881   Transcript: ENSPANT00000024227
Sequence length 771
Comment pep:known_by_projection chromosome:PapAnu2.0:5:142710832:142841385:1 gene:ENSPANG00000023881 transcript:ENSPANT00000024227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRSGRYGTQQQRAGSKTAGPPCQWSRMASEGTNIPSPVVRQIDKQFLICSICLERYKNP
KVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRT
PGSNVEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVP
LKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQK
TLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLV
KKQMSEKLNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGE
GLRQTIIGQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLY
TVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKR
PASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIF
SNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSG
KLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSN
NEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRI
QVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences A0A1D5QPV3 A0A2I3N4T3 A0A2K5J631 A0A2K5V5P8 A0A2K6EBZ8 A0A2K6L029 A0A2K6NU70 G1R1V4
XP_003257898.1.23891 XP_005556155.1.63531 XP_010381184.1.97406 XP_011708921.1.29376 XP_011815169.1.43180 XP_014994842.1.72884 XP_017726587.1.44346 ENSNLEP00000007176 ENSNLEP00000007176 ENSPANP00000015326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]