SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015683 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015683
Domain Number 1 Region: 179-443
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.34e-77
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000238
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-25
Family SH2 domain 0.00000202
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015683
Domain Number - Region: 112-155
Classification Level Classification E-value
Superfamily SH2 domain 0.000263
Family SH2 domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015683   Gene: ENSPANG00000004027   Transcript: ENSPANT00000009687
Sequence length 506
Comment pep:novel chromosome:PapAnu2.0:6:23132414:23133990:-1 gene:ENSPANG00000004027 transcript:ENSPANT00000009687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTSRRWFHPSITGVEAENLMTRGVDGSFLARPTKSNPGDFTLSVGRNGAVTHIKIQNTGD
YYDLYGGEKFATLAELVQCYMEHYGQLKEKNGDVVELKYPLNCADPTSERLKYNVGGGEQ
FDSLTDLEEHYKKNPMMETLGTVLQLKQPLNTTCINACINCRVRELSKLAETTDKVKQGF
WEEFETLQQQEGTPLYSRKEGQRQILPFDHTRVVLQDSDPNEPVSDYIKANIIMSEFETK
CNNSKSRKSYIATQGCLQNMMVFQENSQVIVMTTKEVERGKSKCVKYWPDEYALKEYGVM
HVRSVKESTLHDYTLRELKLSKGGQGNMERMVWQYHFQTWLDHGVPSDPGGMLDFLEEVH
HKQESIMDAGPFVVHCNAGIGRTGTLIVIDTLIDIIREKGVDCDTDVLKTIQMVWSQRSG
MVQTEAQYQFIYMAVQHYIETLQRRIEEQKIKSKGHKYTNIKYSLADQTSGDQSPIPPCT
PTPPCAEMREDSARVENVMQQQKSFR
Download sequence
Identical sequences ENSPANP00000015683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]