SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015781 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015781
Domain Number 1 Region: 1617-1760
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-52
Family Phosphotyrosine-binding domain (PTB) 0.000000425
Further Details:      
 
Domain Number 2 Region: 209-336
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.78e-40
Family PLC-like (P variant) 0.0029
Further Details:      
 
Domain Number 3 Region: 42-207
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.12e-31
Family Dual specificity phosphatase-like 0.00011
Further Details:      
 
Domain Number 4 Region: 1465-1607
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-22
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015781   Gene: ENSPANG00000009910   Transcript: ENSPANT00000017510
Sequence length 1765
Comment pep:known_by_projection chromosome:PapAnu2.0:12:79687514:79788764:-1 gene:ENSPANG00000009910 transcript:ENSPANT00000017510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKLVGKALLKGSARVTPSVQPHLQPIRNMSVSRTMEDSCELDLVYVTERIIAVSFPST
ANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKI
CSICKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASADQALDRFAMKRFY
EDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESKGGCRPFLRIY
QAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKCYHKKFRSPARDVIFRVQFHT
CAIHDLGVVFGKEDLDDAFKDDRFPEYGKVEFVFSYGPEKIQGMEHLENGPSVSVDYNTS
DPLIRWDSYDNFSGHRDDGMEEVVGHTQGPLDGSLYAKVKKKDSLHGSTGAVNATRPTLS
ATPNHVEHTLSVSSDSGNSTASTKTDKTDEPVPGASSAPAALSPQEKRELDRLLSGFGLE
REKQGAMYHTQHLRSRPAGVPAVPSSGRHVVPAQVHVNGGALASERETDILDDELPNQDG
HSAGSVGTLSSLDGVTNTSEGGYPEALSPLTNGLDKPYPMEPMVNGGGYPYESASRAGAA
HAGHTVPMRPSYSAQEGLAGYQREGPHPAWPQPVTTSHYAHDPSSMFRSQSFSEAEPQLP
PAPVRGGSSREAVQRGLNSWQQQQQQQPQPRPPPRQQERVHLESLVASRPSPQPLAETPI
PSLPEFPRAASQQEIEQSIEALNMLMLDLEPASAAAPLHKSQSVPGAWPGASPLSSQPLS
GSSRQSHPLTQSRSGYITSGHSLGTPEPAPRASLESVPPGRSYSPYDYQPCSAGPNQDFR
SKSPASSSLPAFLPTTHSPLGPQQPPASLPGLTAQPLLSPKEATSDPSRTPEEEPLNLEG
LVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELA
LTIALNPGGRPKEPHLHSYKEAFEEMEGTSPSSPPPSGVRSPPGLAKTPLSALGLKPHNP
ADILLHPTGVTRRCIQPEEDEGKVVVRLSEEPRSYVESVARTAVAGPRAQDSEPKSFSAP
AAQAYGHETPLRNGTLGGSFVSPSPLSTSSPILSADSTSVGSFPSGESSDQGPRTPTQPL
LESGFRSGSLGQPSPSAQRNYQSSSPLPTVGSSYSSPDYSLQQFSSSPESQARAQFSVAG
VHTVPGSPQARHRTVGTNTPPSPGFGRRAINPSMAAPSSPSLSHRQVMGPPGTGFHGSTV
SSPQSSAATTPGSPSLGRHPTGAYQVSGLHNNVATTPGSPSLGRHPGAHQGNLASGLHGN
AIASPGSPSLGRHLGGSGSVVPGSPCLDRHVAYGGYSTPEDRRPTVSRQSSASGYQAPST
PSFPVSPAYYPGLSSPATSPSPDSAAFRQGSPTPALPEKRRMSVGDRAGSLPNYATINGK
VSSPVASGMSSPSGGSTVSFSHTLPDFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISR
EQAIALLKDQEPGAFIIRDSHSFRGAYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIE
TGPRGVKLKGCPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTA
DLLKQGAACNVLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTD
NQRKLFFRRHYPLNTVTFCDLDPQERKWMKTEGGAPAKLFGFVARKQGSTTDNACHLFAE
LDPNQPASAIVNFVSKVMLNAGQKR
Download sequence
Identical sequences ENSPANP00000015781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]