SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016120 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016120
Domain Number 1 Region: 235-333
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.78e-31
Family Thioltransferase 0.00000961
Further Details:      
 
Domain Number 2 Region: 136-231
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.67e-28
Family Thioltransferase 0.0000977
Further Details:      
 
Domain Number 3 Region: 14-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.86e-27
Family Thioltransferase 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016120   Gene: ENSPANG00000020159   Transcript: ENSPANT00000021400
Sequence length 335
Comment pep:known_by_projection chromosome:PapAnu2.0:9:121623431:121668294:1 gene:ENSPANG00000020159 transcript:ENSPANT00000021400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGAAEAAVAALEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKEH
PQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGS
FPPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFD
IFSDEEVRQGLKAYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLK
VLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWP
TYPQLYVKGELVGGLDIVKELKENGELLPILRGEN
Download sequence
Identical sequences A0A096NSU9 A0A0D9QWM0 A0A2K5IT19 A0A2K5KIR4 A0A2K5U780
ENSPANP00000016120 ENSMMUP00000024249 XP_001090479.1.72884 XP_005566812.1.63531 XP_011797347.1.43180 XP_011797348.1.43180 XP_011946666.1.92194 ENSMMUP00000024249 9544.ENSMMUP00000024249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]