SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017063 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017063
Domain Number 1 Region: 444-573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000033
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 635-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000838
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 669-710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000485
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 737-863
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000816
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 5 Region: 380-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000133
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 344-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 303-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000181
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 714-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017063
Domain Number - Region: 599-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 878-904
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00392
Family PMP inhibitors 0.0039
Further Details:      
 
Domain Number - Region: 420-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0311
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017063   Gene: ENSPANG00000004885   Transcript: ENSPANT00000015583
Sequence length 1224
Comment pep:known_by_projection chromosome:PapAnu2.0:10:43400324:43434078:-1 gene:ENSPANG00000004885 transcript:ENSPANT00000015583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQREGLIQSHGCPLRVIKSHLVNPEEEMSLVGMVL
GLWYIEFQISFSPRANGFSFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAIC
RQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCD
KDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKET
SLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDAN
ECEAKPCVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCI
CPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPC
QNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYI
SSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCI
CSDGWEGAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATC
NNGGTCYDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGW
EGPICAQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGAT
CVDEINGYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSK
VWCGPRPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYY
QDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHV
AISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLS
SVLTVAWICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTV
PIKDYENKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHP
NWTNKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences ENSPANP00000017063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]