SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017148 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017148
Domain Number 1 Region: 31-182
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-20
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 2 Region: 257-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 420-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000468
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 4 Region: 383-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017148   Gene: ENSPANG00000018432   Transcript: ENSPANT00000015753
Sequence length 651
Comment pep:known_by_projection chromosome:PapAnu2.0:10:55783695:55785940:-1 gene:ENSPANG00000018432 transcript:ENSPANT00000015753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSVGLLLLLLLLLRQLGAGTGADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNL
ATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGG
EDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPRRLPKWSEGPCGSPGSPGSNIEGFVC
KFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLC
KEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTC
ASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVN
TPGSFRCECWVGYEPGGPGEEACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGE
DGTQCHDVDECVGPEGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGP
PDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGS
PGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKLLLFYILGTVVGILLLLALA
LGLLVYRKRRAKREEKKEKPQNAADSYSWVPERAESRAMENQYSPTPGADC
Download sequence
Identical sequences A0A096NVS3
ENSPANP00000017148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]