SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017306 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017306
Domain Number 1 Region: 11-110
Classification Level Classification E-value
Superfamily PX domain 5.76e-21
Family PX domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017306
Domain Number - Region: 112-206
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00491
Family Ubiquitin-related 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017306   Gene: ENSPANG00000016957   Transcript: ENSPANT00000028491
Sequence length 470
Comment pep:known_by_projection chromosome:PapAnu2.0:13:26409175:26414908:1 gene:ENSPANG00000016957 transcript:ENSPANT00000028491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFP
PKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLE
VLLSNGQKVLINVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQ
EFELPYVSVTSLRSQEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVT
KEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQ
LRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQ
WVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLE
SPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL
Download sequence
Identical sequences A0A096NW81 A0A0D9RBW2 A0A1D5QIM9 A0A2K5N176 A0A2K5YKQ5 A0A2K6ANP0 G7PLW2
ENSMMUP00000010866 ENSPANP00000017306 9544.ENSMMUP00000010866 ENSMMUP00000010866 NP_001252904.1.72884 XP_005576337.1.63531 XP_007969329.1.81039 XP_011736251.1.29376 XP_011828008.1.47321 XP_011899634.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]