SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017405 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017405
Domain Number 1 Region: 3387-3560,3600-3780
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.84e-49
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.024
Further Details:      
 
Domain Number 2 Region: 779-816,878-949,1039-1249,1319-1435
Classification Level Classification E-value
Superfamily ARM repeat 6.58e-18
Family MIF4G domain-like 0.078
Further Details:      
 
Domain Number 3 Region: 55-184,289-450
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000000202
Family HEAT repeat 0.063
Further Details:      
 
Domain Number 4 Region: 1578-1660,1766-1915,2090-2351,2431-2451,2547-2620
Classification Level Classification E-value
Superfamily ARM repeat 0.000000339
Family BC3264-like 0.087
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017405
Domain Number - Region: 604-930
Classification Level Classification E-value
Superfamily ARM repeat 0.000173
Family B56-like 0.085
Further Details:      
 
Domain Number - Region: 3055-3130
Classification Level Classification E-value
Superfamily TPR-like 0.00222
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number - Region: 2972-3098
Classification Level Classification E-value
Superfamily TPR-like 0.0173
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017405   Gene: ENSPANG00000006931   Transcript: ENSPANT00000023879
Sequence length 3813
Comment pep:known_by_projection chromosome:PapAnu2.0:3:40167796:40303198:1 gene:ENSPANG00000006931 transcript:ENSPANT00000023879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVATQGATVVDQTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYST
FLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRF
LETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIP
ENTVPPPEMVGMITTIAVKVNPEREDSETRTHSIIPRGSLSLKVLAELPIIVVLMYQLYK
LNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE
LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHILTTELRNQFIPCMDKLFDESIL
IGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSC
KLLLNLVDCIRSKSEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELGAV
EAALPGFEKQGEKDKEDKQTFQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQFIPNKQ
LQPKETQIYIKLVKYAMQALDIYQVQIAGNGQTYIRVANCQTVRMKEEKEVLEHFAGVFT
MMNPLTFKEIFQTTVPYMVERISKNYALQIVANSFLANPTTSALFATILVEYLLDRLPEM
GSNVELSNLYLKLFKLVFGSVSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLL
RALFRSIGGGSHDLLYQEFLPLLPNLLQGLNMLQSAAQQHMKDLVELCLTVPALSSLLPY
LPMLMDPLVSALNGSQTLVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQHCLFFRELS
QKRSSVAYGVFTLKEQYRGNKKQIIKEVVLKTFVYLFIKVHMESLDKLDWRLRLGLSLRK
AIETALDCLKSANTEPYYRRQAWEVIKCFLVAMMSLEDNKHALYQLLAHPNFTEKTIPNV
IISHRYKAQDTPARKTFEQALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPF
LLPCYQVGSQPSTAMFHSEENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDV
ASIILGSKERACQLPLFSYIVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQ
TFLKALLFVMMDLTGEVSNGAVAMAKTTLEQLLMRCATPLKDEERAEEIVAAQEKSFHHV
THDLVREVTSPNSTVRKQAMHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQP
ANAQIGLMEGNTFCTTLQPRLFTMDLNVVEHKVFYTELLNLCEAEDSALTKLPCYKSLPS
LVPLRIAALNALAACNYLPQSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVD
QIHTHMRPLLMMLGDYRSLTLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVIT
HKGGQRSDGNEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLI
KFLTRHPSQTVELFMMEATLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLLLPGG
AQTAVRPGSPSTSTMRLDLQFQAVKIISIIVKNDDSWLASQHSLVSQLRRVWVSETFQER
HRKENMAATNWKEPKLLAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEE
IPKNYSITQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEKGEGEQLLGPPNP
EGDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHDNNKNRNSKLR
RLMTFAWPCLLSKACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAI
VRQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRH
HLVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGV
NSVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVN
FLIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLMTVEQP
NQVNYGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKVLRAVHSLLSRL
MSIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYEKATNANPSQLFGTLMILKSAC
SNNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSGRAGTSELVMLSLELVKTRLA
VMSMEMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQTPTLREKSILL
VKMMTYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRA
KFFEVFDNSMKRRVYERLLYVTCSQNWEAMGNHFWIKQCIELLLAVCEKSTPIGTSCQGA
MLPSITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEEDVEIDIELAPGDQTSTPKT
KELSEKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRL
WKILSDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYL
GKTHNLWFRSTLMLEHQAFEKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQ
EEDMWAGLWQKRCKYSETATAIAYEQHGFFEQPEFTXYEKAMDKAKKEHERSNASPAIFP
EYQLWEDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVS
CPKEMAWKVNMYRGYLAICHPEEQQLSFIERLVEMASSLAIREWRRLPHVVSHVHTPLLQ
AAQQIIELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWR
QHHYQAIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDILSRIHT
IPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQQGLEVIESTNLKYFTKEMTAEFYALK
GMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFVKERQLHLGVSAITCYLH
ACRHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLTCLVGS
EGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDSGQQQPSSVGNQSHSASD
PGPIRATAPMWRCSRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAKC
YSVAFEKSGAVSDAKITPHTLNFVKKLVSTFGVGLENVSNVSTMFSSAASESLARRAQAT
AQDPVFQKLKGQFTTEDFDFSVPGSMKLHNLISKLKKWIKILEAKTKQLPKFFLIEEKCR
FLSNFSAQTAEVEIPGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIY
PYLVMNDACLTESRREERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSPQMRLVED
NPSSLSLVEIYKQRCAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDILKEVQSNMV
PRSMLKEWALHTFPNATDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLN
VAYFRFDINDATGDLDANRPVPFRLTPNISEFLTTIGVSGPLTASMIAVARCFAQPNFKV
DGILKTVLRDEIIAWHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLA
QFEGGESKVNTLVAAANSLDNLCRMDPAWHPWL
Download sequence
Identical sequences ENSPANP00000017405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]