SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017555 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017555
Domain Number 1 Region: 74-265
Classification Level Classification E-value
Superfamily vWA-like 9.6e-56
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 268-390
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000408
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 393-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 443-481
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000693
Family Chicken cartilage matrix protein 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017555   Gene: ENSPANG00000019588   Transcript: ENSPANT00000028065
Sequence length 487
Comment pep:known_by_projection chromosome:PapAnu2.0:13:19003566:19024020:-1 gene:ENSPANG00000019588 transcript:ENSPANT00000028065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPAPARRLPGLLLLLWPLLLLLPLAAPDPVARPGFRRLGTRGPEGSPGRRPSSVAPDG
APASGASEPGRASGAGVCKSRPLDLVFLIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPAD
TRVAVVNYASTVKIEFQLQAYTDKQSLKQAVGRITPLSTGTMSGLAIQTAMDEVFTAEAG
ARGPSSNIPKVAIIVTDGRPQDQVNEVAARARASGIELYAVGVDRADMQSLKMMASEPLE
EHVFYVETYGVIEKLSSRFQETFCGLDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNA
DKKTCSALDKCALNIHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGC
QHICVNDRTGSYHCECYDGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYP
GYTLNEDKKTCSAIEEARRLVSTEDVCGCEATLAFQEKVSSSLQRLNTKLDGILEKLQVN
EYGQIHR
Download sequence
Identical sequences A0A096NWW9
ENSPANP00000017555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]