SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017693 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017693
Domain Number 1 Region: 131-376
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-64
Family Nuclear receptor ligand-binding domain 0.00000000128
Further Details:      
 
Domain Number 2 Region: 59-137
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-28
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017693   Gene: ENSPANG00000026281   Transcript: ENSPANT00000018515
Sequence length 476
Comment pep:known_by_projection chromosome:PapAnu2.0:10:19820261:19847573:-1 gene:ENSPANG00000026281 transcript:ENSPANT00000018515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNGADTSPSEGTNLNAPSSLGVSA
LCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLK
KCFRAGMKKEAAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIR
AKKIASIADVCESMKEQLLVLVEWAKYIPAFCEPLDDQVALLRAHAGEHLLLGATKRSMV
FKDVLLLGNDYIVPRHCPELAEMSRVSMRILDELVLPFQELQIDDNEYAYLKAIIFFDPD
AKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFI
KLFGMAKIDNLLQEMLLGGSSSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMC
EWPRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI
Download sequence
Identical sequences ENSPANP00000017693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]