SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017772 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017772
Domain Number 1 Region: 335-501,581-695
Classification Level Classification E-value
Superfamily L domain-like 6.81e-51
Family Ngr ectodomain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 95-302
Classification Level Classification E-value
Superfamily L domain-like 3.74e-41
Family Ngr ectodomain-like 0.00027
Further Details:      
 
Domain Number 3 Region: 969-1159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-39
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 2-61
Classification Level Classification E-value
Superfamily L domain-like 0.000000000252
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 5 Region: 822-938
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000033
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 783-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 740-781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000409
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 8 Region: 1243-1271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000138
Family EGF-type module 0.021
Further Details:      
 
Domain Number 9 Region: 1196-1233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000377
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017772
Domain Number - Region: 1162-1193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00135
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017772   Gene: ENSPANG00000005313   Transcript: ENSPANT00000007449
Sequence length 1350
Comment pep:known_by_projection chromosome:PapAnu2.0:6:162071839:162288758:-1 gene:ENSPANG00000005313 transcript:ENSPANT00000007449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFTLCMAPV
HLRGFNVADVQKKEYVCPGSTAPHSEPPSCNANSISCPSPCTCSNNIVDCRGKGLTEIPA
NLPEGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLY
GNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISKGLF
APLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKF
RCSASELPNILPGCSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEY
VTDLRLNDNEISVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQL
ETVHGRMFRGLSGLKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLV
SLSTINLLSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDG
NDESSCQLSPRCPEQCTCVETVVRCSNKGLRALPKGMPKDVTELYLEGNHLTAVPRELSA
LRHLTLIDLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPIHAFNGLRSLRVLTLHGN
DISSVPEGSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADR
LLLTTPTHRFQCKGPVDINIAAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCT
VPINTCIQNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVD
GINNYVCVCPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFRCECVPGYSGKLCET
DNDDCVAHKCRHGAQCMDTINGYTCTCPQGFSGPFCEHPPPMVLLQTSPCDQYECQNGAQ
CIVVQQEPTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNG
ILLYKGDNDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLV
VDKGTPKSLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINN
ELQDFKALPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECHPGWTGPLCDQEARDPCL
GHSCNHGKCVATGTSYMCKCAEGYGGALCDNKNDSANACSAFKCHHGQCHISDQGEPYCL
CQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATASKVPIMECHGGCGPQCCQPTRSK
RRKYVFQCTDGSSFVEEVERHLECGCLGCS
Download sequence
Identical sequences ENSPANP00000017772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]