SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017868 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017868
Domain Number 1 Region: 14-64
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000137
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000017868
Domain Number - Region: 146-218
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0023
Family Ubiquitin-related 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017868   Gene: ENSPANG00000018511   Transcript: ENSPANT00000012534
Sequence length 242
Comment pep:known_by_projection chromosome:PapAnu2.0:1:3322987:3380766:-1 gene:ENSPANG00000018511 transcript:ENSPANT00000012534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIH
QSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLD
SHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQA
TVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMD
LL
Download sequence
Identical sequences A0A096NXR6 A0A0D9RS45 A0A1U7TWJ4 A0A2I3FZ44 A0A2J8SSD9 A0A2K5K815 A0A2K5RM03 A0A2K5ZEB4 A0A2K6DR71 A0A2K6ME53 A0A2K6NJ62 A0A2K6TJS4 G2HE92 G3R0N5 G7MG60 G7NWQ3 Q3KNV8 U3CMK6
ENSGGOP00000008727 ENSP00000383015 9606.ENSP00000354724 gi|31742478|ref|NP_006306.2| ENSNLEP00000001101 ENSGGOP00000008727 NP_001245100.1.72884 NP_001289366.1.37143 NP_001304765.1.87134 NP_001304765.1.92137 NP_006306.2.87134 NP_006306.2.92137 XP_003280595.1.23891 XP_008062195.1.4292 XP_008961968.1.60992 XP_008991983.1.60252 XP_010343457.1.74449 XP_010373622.1.97406 XP_011743090.1.29376 XP_011743091.1.29376 XP_011743092.1.29376 XP_011743093.1.29376 XP_011792192.1.43180 XP_011826296.1.47321 XP_011826297.1.47321 XP_011826298.1.47321 XP_014993273.1.72884 XP_014993274.1.72884 XP_014993275.1.72884 XP_015305489.1.63531 XP_015305490.1.63531 XP_017394428.1.71028 XP_017720909.1.44346 XP_017720910.1.44346 XP_017826218.1.60252 XP_018880739.1.27298 XP_018880740.1.27298 ENSP00000354724 ENSP00000420489 ENSP00000423393 ENSPANP00000017868 ENSP00000354724 ENSP00000420489 ENSP00000423393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]