SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017871 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017871
Domain Number 1 Region: 635-771
Classification Level Classification E-value
Superfamily EF-hand 0.00000000137
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 465-518,555-679
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000408
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017871   Gene: ENSPANG00000008259   Transcript: ENSPANT00000006283
Sequence length 961
Comment pep:known_by_projection chromosome:PapAnu2.0:5:79529851:79598402:1 gene:ENSPANG00000008259 transcript:ENSPANT00000006283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLRDQRGLEIEMQRIR
QAAARDPPAGASASPSPPLSSCSRQAWSRDNPGFEVEGEEGGMVVEMDVEWRPGSRRSAA
SSAVSSAGARGRGLGGYHSAGHPSGRRRRREDQGPPCPSPAGGGDPLHRHLPLDGQAPRV
AWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVY
YYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRS
FIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWI
YTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFS
VYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFILYY
VVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGISIYRTSNVEVLLQFLEDQNTFPN
FEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFII
FLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFF
MFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHRALVKLKLKKNTVDDISE
SLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKERE
DLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVD
RMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMER
LVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVH
V
Download sequence
Identical sequences ENSPANP00000017871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]