SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000017951 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000017951
Domain Number 1 Region: 525-769
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.33e-64
Family Eukaryotic proteases 0.00000000423
Further Details:      
 
Domain Number 2 Region: 114-230
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-26
Family Spermadhesin, CUB domain 0.000000534
Further Details:      
 
Domain Number 3 Region: 273-386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-24
Family Spermadhesin, CUB domain 0.0000596
Further Details:      
 
Domain Number 4 Region: 458-529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.000026
Further Details:      
 
Domain Number 5 Region: 404-461
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000876
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 226-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000118
Family EGF-type module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000017951   Gene: ENSPANG00000006741   Transcript: ENSPANT00000016861
Sequence length 772
Comment pep:novel chromosome:PapAnu2.0:11:7230292:7241401:1 gene:ENSPANG00000006741 transcript:ENSPANT00000016861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPKEGASRPCAAVPGGRSGCPACPLAGDRGLTRLLLPASEGKILTNETTLSQWGSTSFSD
CLSQGPCLPLVKEAPASTCGRWEHQQRCSSHRAPAFRCIVLFSLLAWVYAEPTMYGEILS
PNYPQAYPSEVEKSWDIEVPEEVPEGYGIHLYFTHLDIELSENCAYDSVQIMSGDIEEGR
LCGQRTSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTEFAAYYVATDINECTDFVDA
PCSHFCNNFTGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALTGEIASPNYPKPYPENSR
CEYQIRLEEGFQVVVTVRREDFDVEPADSEGNCLDGLVFVAGDQQFGPYCGRGFPGPLNI
ETKSNVLDIIFQTDLTGQNKGWKLRYHGDPMPCPKEDTPTSVWEPAKAKYVFRDVVRITC
LDGFESLQGRVGATSFHSTCQSNGKWSNSKLKCQPVDCGIPESIENGKVEDPESTLFGSV
TRCTCEEPYYYMENGGNGRQYHCASNGSWVNEALSPELPKCVPVCGVPREPFEEKQRIIG
GSDADIKNFPWQVFFDPWAGGALIDEYWVLTAAHVVEGNQEPTMYVGSTSVQTSRLAKSK
MLTSERVFIHPGWKLLEVPEARTNFDNDIALVQLKDPVKMGPNVAPICLPGTSSDYNLMD
GDLGLIAGWGQTEKRDRALRLKAARLPVAPLRKCREVKVENPKADAGAYVFTPNMICAGG
EKGMDSCKGDSGGAFAVQDPNDKAKFYVAGLVSWGPQCGTYGLYTRVDYAGK
Download sequence
Identical sequences ENSPANP00000017951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]